Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5557
Gene name
LocationContig_556:3090..4706
Strand+
Gene length (bp)1616
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03849 Tfb2 Transcription factor Tfb2 5.0E-133 13 402
PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain 1.3E-19 422 487

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BZX4|TFB2_YARLI RNA polymerase II transcription factor B subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB2 PE=3 SV=1 11 491 2.0E-115
sp|Q75B51|TFB2_ASHGO RNA polymerase II transcription factor B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB2 PE=3 SV=1 13 491 2.0E-113
sp|Q6BGW8|TFB2_DEBHA RNA polymerase II transcription factor B subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB2 PE=3 SV=2 1 491 9.0E-112
sp|Q6CLR2|TFB2_KLULA RNA polymerase II transcription factor B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB2 PE=3 SV=1 13 485 3.0E-111
sp|P87303|TFB2_SCHPO RNA polymerase II transcription factor B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb2 PE=1 SV=2 11 489 5.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BZX4|TFB2_YARLI RNA polymerase II transcription factor B subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB2 PE=3 SV=1 11 491 2.0E-115
sp|Q75B51|TFB2_ASHGO RNA polymerase II transcription factor B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TFB2 PE=3 SV=1 13 491 2.0E-113
sp|Q6BGW8|TFB2_DEBHA RNA polymerase II transcription factor B subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TFB2 PE=3 SV=2 1 491 9.0E-112
sp|Q6CLR2|TFB2_KLULA RNA polymerase II transcription factor B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TFB2 PE=3 SV=1 13 485 3.0E-111
sp|P87303|TFB2_SCHPO RNA polymerase II transcription factor B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfb2 PE=1 SV=2 11 489 5.0E-111
sp|Q6FP41|TFB2_CANGA RNA polymerase II transcription factor B subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TFB2 PE=3 SV=1 11 489 1.0E-102
sp|Q02939|TFB2_YEAST RNA polymerase II transcription factor B subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB2 PE=1 SV=1 11 489 1.0E-100
sp|O70422|TF2H4_MOUSE General transcription factor IIH subunit 4 OS=Mus musculus GN=Gtf2h4 PE=1 SV=1 6 492 5.0E-83
sp|P60027|TF2H4_PANTR General transcription factor IIH subunit 4 OS=Pan troglodytes GN=GTF2H4 PE=3 SV=1 1 492 9.0E-83
sp|Q92759|TF2H4_HUMAN General transcription factor IIH subunit 4 OS=Homo sapiens GN=GTF2H4 PE=2 SV=1 1 492 9.0E-83
sp|Q54C29|TF2H4_DICDI General transcription factor IIH subunit 4 OS=Dictyostelium discoideum GN=gtf2h4 PE=3 SV=1 14 487 3.0E-58
[Show less]

GO

GO Term Description Terminal node
GO:0001671 ATPase activator activity Yes
GO:0006289 nucleotide-excision repair Yes
GO:0000439 transcription factor TFIIH core complex Yes
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0090575 RNA polymerase II transcription regulator complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0140513 nuclear protein-containing complex No
GO:0006259 DNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0032991 protein-containing complex No
GO:0098772 molecular function regulator activity No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0005667 transcription regulator complex No
GO:0006281 DNA repair No
GO:0033554 cellular response to stress No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140677 molecular function activator activity No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006950 response to stress No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5557
MASSPMKTLQLADYLERLPGTTFRKLYQQPSTAFAIFRRMLPHLAKTLVMRCLYMPKPMLLSDLDLWVRPEAKRE
KDQALSILRGLHIIQITAPSKEKPQEMFLTANFKESMRLALTGGGTHNSFGVPSTLTVPQEITVPFLDRYARKKW
DDILHFVVSSVGFKSAGDVSGPNKSVKELLVAGRLVDRRPGGGVGITQAGFTFLLQEANAQVWTLLLLWLEASDL
NKAAGFETVDMLSFLFVLATLELGRAYDTNALTEQRKNMLPSLLDFGLIYIPQHKRSMFFPTRLATTLTNGAGGL
RSISDGVTAATSSASQQQGSSGGLLAAAGEQKGSVIVETNYRLYAYTQSTLQIAVLALFAKLHMRFPDMVAGRLS
RASIRQAINFGISADQIVSYLAAHAHEQMHRSAAVSNKPVLPPTVVDQIRLWQLENERMKTTGGFLFRDFDDHKE
YLDTARFASEIGVCVWRSDKTGMFFASKHEQIRDYLKSRKRAE*
Coding >Ophun1|5557
ATGGCTTCCAGCCCGATGAAGACGCTGCAGCTGGCCGACTACCTGGAGAGGCTACCGGGGACGACTTTCAGGAAG
CTCTATCAGCAGCCTTCGACGGCCTTTGCCATTTTCCGACGCATGCTGCCGCATCTAGCGAAAACGCTCGTGATG
CGCTGCCTGTACATGCCCAAGCCCATGCTCCTCAGCGACCTGGATCTCTGGGTCCGTCCCGAAGCGAAACGGGAA
AAGGACCAGGCGCTCTCCATCCTGCGAGGCCTGCACATCATACAGATCACGGCGCCGTCCAAGGAGAAGCCGCAG
GAGATGTTCCTGACGGCCAACTTCAAAGAGTCGATGCGTCTCGCCCTTACTGGCGGCGGAACGCACAACTCGTTT
GGAGTCCCCTCGACGCTGACGGTCCCGCAAGAGATCACGGTGCCATTCCTCGACCGGTACGCGCGCAAGAAGTGG
GACGACATCCTTCACTTTGTCGTCTCCAGCGTCGGCTTCAAGAGCGCGGGCGACGTCTCCGGACCGAACAAGAGC
GTCAAGGAGCTGCTCGTCGCCGGCCGCCTCGTCGACAGGAGACCCGGGGGCGGCGTCGGCATCACCCAGGCCGGC
TTCACCTTTTTGCTGCAAGAGGCCAACGCCCAAGTCTGGACCCTGCTTCTGCTGTGGCTCGAAGCCAGCGATCTC
AACAAGGCGGCCGGCTTCGAGACGGTCGACATGCTCTCCTTTCTCTTCGTCCTCGCCACGCTCGAGCTGGGCAGG
GCCTACGACACCAACGCGCTGACGGAGCAGCGCAAGAACATGCTCCCCTCGCTGCTCGACTTTGGCCTCATCTAC
ATCCCCCAGCACAAACGCTCCATGTTCTTCCCCACCCGCTTGGCCACGACGCTGACCAACGGAGCCGGAGGCCTA
CGGTCCATCAGCGACGGCGTCACGGCGGCGACGTCATCCGCCTCGCAGCAGCAGGGCTCGTCAGGAGGCCTCCTC
GCAGCGGCAGGCGAGCAAAAGGGCAGCGTCATCGTCGAGACCAACTACCGCCTATACGCCTACACGCAATCCACG
CTACAGATCGCCGTGCTCGCCCTCTTCGCAAAGCTCCACATGCGCTTCCCGGACATGGTAGCCGGCCGCCTCTCC
CGCGCCTCCATCCGACAAGCCATCAACTTTGGCATCTCAGCCGACCAGATCGTCTCGTACCTCGCCGCCCACGCC
CACGAGCAGATGCACCGCTCAGCCGCCGTCTCCAACAAGCCCGTGCTTCCCCCCACCGTCGTCGATCAGATCCGG
CTCTGGCAGCTGGAGAATGAGCGGATGAAGACGACGGGCGGCTTCCTCTTCCGCGACTTTGACGACCACAAGGAG
TATCTCGACACGGCCAGGTTCGCGTCCGAGATTGGCGTCTGCGTCTGGCGGAGCGATAAGACGGGCATGTTCTTC
GCCAGCAAGCACGAGCAAATCCGGGACTACCTTAAGAGTCGGAAGCGTGCCGAGTAG
Transcript >Ophun1|5557
ATGGCTTCCAGCCCGATGAAGACGCTGCAGCTGGCCGACTACCTGGAGAGGCTACCGGGGACGACTTTCAGGAAG
CTCTATCAGCAGCCTTCGACGGCCTTTGCCATTTTCCGACGCATGCTGCCGCATCTAGCGAAAACGCTCGTGATG
CGCTGCCTGTACATGCCCAAGCCCATGCTCCTCAGCGACCTGGATCTCTGGGTCCGTCCCGAAGCGAAACGGGAA
AAGGACCAGGCGCTCTCCATCCTGCGAGGCCTGCACATCATACAGATCACGGCGCCGTCCAAGGAGAAGCCGCAG
GAGATGTTCCTGACGGCCAACTTCAAAGAGTCGATGCGTCTCGCCCTTACTGGCGGCGGAACGCACAACTCGTTT
GGAGTCCCCTCGACGCTGACGGTCCCGCAAGAGATCACGGTGCCATTCCTCGACCGGTACGCGCGCAAGAAGTGG
GACGACATCCTTCACTTTGTCGTCTCCAGCGTCGGCTTCAAGAGCGCGGGCGACGTCTCCGGACCGAACAAGAGC
GTCAAGGAGCTGCTCGTCGCCGGCCGCCTCGTCGACAGGAGACCCGGGGGCGGCGTCGGCATCACCCAGGCCGGC
TTCACCTTTTTGCTGCAAGAGGCCAACGCCCAAGTCTGGACCCTGCTTCTGCTGTGGCTCGAAGCCAGCGATCTC
AACAAGGCGGCCGGCTTCGAGACGGTCGACATGCTCTCCTTTCTCTTCGTCCTCGCCACGCTCGAGCTGGGCAGG
GCCTACGACACCAACGCGCTGACGGAGCAGCGCAAGAACATGCTCCCCTCGCTGCTCGACTTTGGCCTCATCTAC
ATCCCCCAGCACAAACGCTCCATGTTCTTCCCCACCCGCTTGGCCACGACGCTGACCAACGGAGCCGGAGGCCTA
CGGTCCATCAGCGACGGCGTCACGGCGGCGACGTCATCCGCCTCGCAGCAGCAGGGCTCGTCAGGAGGCCTCCTC
GCAGCGGCAGGCGAGCAAAAGGGCAGCGTCATCGTCGAGACCAACTACCGCCTATACGCCTACACGCAATCCACG
CTACAGATCGCCGTGCTCGCCCTCTTCGCAAAGCTCCACATGCGCTTCCCGGACATGGTAGCCGGCCGCCTCTCC
CGCGCCTCCATCCGACAAGCCATCAACTTTGGCATCTCAGCCGACCAGATCGTCTCGTACCTCGCCGCCCACGCC
CACGAGCAGATGCACCGCTCAGCCGCCGTCTCCAACAAGCCCGTGCTTCCCCCCACCGTCGTCGATCAGATCCGG
CTCTGGCAGCTGGAGAATGAGCGGATGAAGACGACGGGCGGCTTCCTCTTCCGCGACTTTGACGACCACAAGGAG
TATCTCGACACGGCCAGGTTCGCGTCCGAGATTGGCGTCTGCGTCTGGCGGAGCGATAAGACGGGCATGTTCTTC
GCCAGCAAGCACGAGCAAATCCGGGACTACCTTAAGAGTCGGAAGCGTGCCGAGTAG
Gene >Ophun1|5557
ATGGCTTCCAGCCCGATGAAGACGCTGCAGCTGGCCGACTACCTGGAGAGGCTACCGGGGACGACTTTCAGGAAG
CTCTATCAGCAGCCTTCGACGGCCTTTGCCATTTTCCGACGCATGCTGCCGCATCTAGGTCTGCTCTTGCTCTGT
GTATGTGTTTTTGTGTGTTTATGAATGGCTGCTAATGGGGGATTCTCGCAGCGAAAACGCTCGTGATGCGCTGCC
TGTACATGCCCAAGCCCATGCTCCTCAGCGACCTGGATCTCTGGGTCCGTCCCGAAGCGAAACGGTGAGATTACG
GAAGAAAGAACAAACAGGCTCCTTGAGAAATATCGGCTGAGATGTACTCACTCAGGGAAAAGGACCAGGCGCTCT
CCATCCTGCGAGGCCTGCACATCATACAGATCACGGCGCCGTCCAAGGAGAAGCCGCAGGAGATGTTCCTGACGG
CCAACTTCAAAGAGTCGATGCGTCTCGCCCTTACTGGCGGCGGAACGCACAACTCGTTTGGAGTCCCCTCGACGC
TGACGGTCCCGCAAGAGATCACGGTGCCATTCCTCGACCGGTACGCGCGCAAGAAGTGGGACGACATCCTTCACT
TTGTCGTCTCCAGCGTCGGCTTCAAGAGCGCGGGCGACGTCTCCGGACCGAACAAGAGCGTCAAGGAGCTGCTCG
TCGCCGGCCGCCTCGTCGACAGGAGACCCGGGGGCGGCGTCGGCATCACCCAGGCCGGCTTCACCTTTTTGCTGC
AAGAGGCCAACGCCCAAGTCTGGACCCTGCTTCTGCTGTGGCTCGAAGCCAGCGATCTCAACAAGGCGGCCGGCT
TCGAGACGGTCGACATGCTCTCCTTTCTCTTCGTCCTCGCCACGCTCGAGCTGGGCAGGGCCTACGACACCAACG
CGCTGACGGAGCAGCGCAAGAACATGCTCCCCTCGCTGCTCGACTTTGGCCTCATCTACATCCCCCAGCACAAAC
GCTCCATGTTCTTCCCCACCCGCTTGGCCACGACGCTGACCAACGGAGCCGGAGGCCTACGGTCCATCAGCGACG
GCGTCACGGCGGCGACGTCATCCGCCTCGCAGCAGCAGGGCTCGTCAGGAGGCCTCCTCGCAGCGGCAGGCGAGC
AAAAGGGCAGCGTCATCGTCGAGACCAACTACCGCCTATACGCCTACACGCAATCCACGCTACAGATCGCCGTGC
TCGCCCTCTTCGCAAAGCTCCACATGCGCTTCCCGGACATGGTAGCCGGCCGCCTCTCCCGCGCCTCCATCCGAC
AAGCCATCAACTTTGGCATCTCAGCCGACCAGATCGTCTCGTACCTCGCCGCCCACGCCCACGAGCAGATGCACC
GCTCAGCCGCCGTCTCCAACAAGCCCGTGCTTCCCCCCACCGTCGTCGATCAGATCCGGCTCTGGCAGCTGGAGA
ATGAGCGGATGAAGACGACGGGCGGCTTCCTCTTCCGCGACTTTGACGACCACAAGGAGTATCTCGACACGGCCA
GGTTCGCGTCCGAGATTGGCGTCTGCGTCTGGCGGAGCGATAAGACGGGCATGTTCTTCGCCAGCAAGCACGAGC
AAATCCGGGACTACCTTAAGAGTCGGAAGCGTGCCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail