Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5554
Gene name
LocationContig_555:8721..11422
Strand+
Gene length (bp)2701
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 3.0E-23 150 280
PF15932 DUF4748 Domain of unknown function (DUF4748) 1.3E-20 3 50

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 25 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5554
MNTVRSFWIGWGSLCVAGAGAYYLAKREINADRQSKLEQARKKQLETRALDLGATAEHARTDSAGSPSQEACSDP
APTRHAPTTESERVSEKSNFLPVVHLAAPPRDGTRVSDIMVVTPDLAVARSNLITLLSRADPESLSRTAAFEFLE
LLDNTLDECSRPNVQKCKNWILANVAPSDERAFALGRYLVALSESMEKDFDRPSVRRRRLHVLYIASDVLYHAVI
CRDDQHLSRAWEGHLPAMIATASTFEKCPKHLSKVRALIDLWEEKRYLYPDVILKLRDSFTRASDKESGTRIQMS
SAALELAKEAPFLIPSTHGEASVPWNDLPAATWLAQLKPGSTQLMRRNLVRPIQLNQGAAPQPLVQVVKDTLQEA
KTLYVKDHLRDRTGLDFNLMGETQTQPGTREAATYWGWTPKLCRRVKQGQHCVETIPQNIVPSRSRSKSRASSPR
RSRSPKRKYTSRSEASRSPIRRRSRSRSRSPPRRRTGPNTSSNFRRRSPARHDRRNASYSRSRSRSPTPRRRRDA
SYSRSRSPAPRRGRTDRRRSYTESASHDSSRSRSYSHGQSRRPHRRSSRSASPPFREGRPYRDPQGDHRSHQPPT
NPPPHPQGTTEAFPAPPPPPPLPESTEMTAAQREFRAQEEALERENEEAQRLEDEGRMMEAATKGDLRKDVILAA
*
Coding >Ophun1|5554
ATGAATACGGTCCGATCTTTCTGGATTGGATGGGGCTCTCTTTGCGTCGCCGGAGCCGGCGCGTACTACCTGGCC
AAACGCGAGATCAACGCCGACCGCCAGTCGAAGCTCGAACAGGCTCGCAAGAAGCAGCTTGAGACTCGGGCATTG
GATCTGGGTGCTACCGCCGAGCACGCGAGGACGGATAGCGCTGGCTCACCCAGCCAGGAGGCCTGCTCAGATCCC
GCGCCGACGAGACATGCGCCGACGACCGAGTCCGAGCGAGTATCGGAAAAGAGCAACTTCCTCCCCGTCGTCCAT
CTGGCCGCGCCGCCACGCGACGGGACGCGTGTCTCCGACATCATGGTCGTGACGCCGGACCTTGCCGTTGCCAGA
TCCAATCTTATAACCCTGCTGTCGCGCGCCGATCCTGAATCCTTGAGTCGGACAGCGGCTTTCGAATTTCTCGAG
CTACTCGACAATACGCTCGATGAGTGTTCGCGGCCCAACGTTCAGAAATGCAAGAACTGGATCCTCGCCAACGTC
GCCCCCTCCGACGAACGAGCCTTTGCGCTGGGAAGATACCTCGTCGCCCTTTCAGAGAGCATGGAGAAGGACTTT
GACCGTCCCAGCGTCCGACGTCGTCGTCTCCACGTTCTCTACATCGCCAGCGACGTCCTGTACCATGCCGTCATC
TGCCGCGACGACCAGCACCTCTCCCGCGCCTGGGAAGGCCATCTGCCGGCCATGATTGCGACGGCATCCACGTTT
GAGAAGTGTCCCAAGCACCTTTCCAAGGTCCGCGCCCTCATTGATCTTTGGGAAGAGAAGCGCTATCTGTACCCG
GACGTGATTCTCAAACTCAGAGACTCCTTCACTCGCGCCTCCGACAAGGAGTCCGGCACTCGAATTCAGATGTCG
TCGGCTGCCCTTGAGCTCGCCAAGGAAGCGCCCTTCCTGATTCCTTCGACTCACGGCGAAGCTTCCGTGCCGTGG
AACGACTTGCCCGCCGCGACTTGGCTTGCACAGCTGAAGCCCGGCTCAACACAGCTCATGCGCCGCAACCTGGTG
CGGCCCATCCAGCTCAACCAAGGTGCCGCGCCTCAGCCACTGGTCCAAGTGGTCAAAGATACGCTCCAAGAAGCC
AAAACTCTGTACGTCAAGGATCATCTTCGAGACAGGACAGGCCTCGACTTCAACCTCATGGGAGAAACTCAAACC
CAGCCCGGCACTCGCGAAGCCGCTACCTATTGGGGCTGGACGCCCAAGCTCTGCCGTCGCGTCAAGCAAGGCCAA
CACTGCGTCGAGACCATCCCTCAGAACATCGTTCCCTCCCGCTCGCGCTCCAAATCCAGAGCCTCATCTCCGCGA
CGAAGCCGTTCCCCCAAGCGAAAGTACACATCCCGATCCGAAGCAAGCCGCAGCCCCATCCGACGCCGAAGCCGC
AGCCGCAGCCGCAGCCCCCCCCGTCGCCGAACCGGCCCCAACACAAGCAGCAACTTCAGACGACGCAGTCCAGCC
CGTCACGATCGCAGAAACGCCTCGTACAGCCGCAGCCGCAGCCGCAGCCCGACTCCGCGCCGACGCAGAGACGCC
TCCTACAGCCGCAGCCGTAGTCCGGCTCCGCGGCGGGGCCGAACTGACCGTCGACGCTCCTACACCGAGTCCGCA
TCGCACGACTCTTCTCGATCGCGCTCCTACTCACACGGACAATCAAGACGTCCTCACCGACGCTCCTCTCGCTCC
GCCAGCCCTCCCTTCCGCGAAGGCCGCCCATACCGCGACCCCCAAGGCGATCACCGCTCCCACCAACCACCCACC
AACCCACCGCCTCACCCCCAAGGCACCACCGAAGCCTTTCCCGCTCCGCCCCCTCCGCCTCCCCTGCCGGAAAGT
ACCGAGATGACGGCTGCGCAGCGCGAGTTCCGCGCCCAGGAGGAGGCGCTCGAGCGGGAGAATGAGGAAGCGCAG
AGGCTCGAGGACGAGGGAAGGATGATGGAGGCGGCGACAAAGGGCGACTTGCGCAAGGATGTTATCCTCGCGGCG
TGA
Transcript >Ophun1|5554
ATGAATACGGTCCGATCTTTCTGGATTGGATGGGGCTCTCTTTGCGTCGCCGGAGCCGGCGCGTACTACCTGGCC
AAACGCGAGATCAACGCCGACCGCCAGTCGAAGCTCGAACAGGCTCGCAAGAAGCAGCTTGAGACTCGGGCATTG
GATCTGGGTGCTACCGCCGAGCACGCGAGGACGGATAGCGCTGGCTCACCCAGCCAGGAGGCCTGCTCAGATCCC
GCGCCGACGAGACATGCGCCGACGACCGAGTCCGAGCGAGTATCGGAAAAGAGCAACTTCCTCCCCGTCGTCCAT
CTGGCCGCGCCGCCACGCGACGGGACGCGTGTCTCCGACATCATGGTCGTGACGCCGGACCTTGCCGTTGCCAGA
TCCAATCTTATAACCCTGCTGTCGCGCGCCGATCCTGAATCCTTGAGTCGGACAGCGGCTTTCGAATTTCTCGAG
CTACTCGACAATACGCTCGATGAGTGTTCGCGGCCCAACGTTCAGAAATGCAAGAACTGGATCCTCGCCAACGTC
GCCCCCTCCGACGAACGAGCCTTTGCGCTGGGAAGATACCTCGTCGCCCTTTCAGAGAGCATGGAGAAGGACTTT
GACCGTCCCAGCGTCCGACGTCGTCGTCTCCACGTTCTCTACATCGCCAGCGACGTCCTGTACCATGCCGTCATC
TGCCGCGACGACCAGCACCTCTCCCGCGCCTGGGAAGGCCATCTGCCGGCCATGATTGCGACGGCATCCACGTTT
GAGAAGTGTCCCAAGCACCTTTCCAAGGTCCGCGCCCTCATTGATCTTTGGGAAGAGAAGCGCTATCTGTACCCG
GACGTGATTCTCAAACTCAGAGACTCCTTCACTCGCGCCTCCGACAAGGAGTCCGGCACTCGAATTCAGATGTCG
TCGGCTGCCCTTGAGCTCGCCAAGGAAGCGCCCTTCCTGATTCCTTCGACTCACGGCGAAGCTTCCGTGCCGTGG
AACGACTTGCCCGCCGCGACTTGGCTTGCACAGCTGAAGCCCGGCTCAACACAGCTCATGCGCCGCAACCTGGTG
CGGCCCATCCAGCTCAACCAAGGTGCCGCGCCTCAGCCACTGGTCCAAGTGGTCAAAGATACGCTCCAAGAAGCC
AAAACTCTGTACGTCAAGGATCATCTTCGAGACAGGACAGGCCTCGACTTCAACCTCATGGGAGAAACTCAAACC
CAGCCCGGCACTCGCGAAGCCGCTACCTATTGGGGCTGGACGCCCAAGCTCTGCCGTCGCGTCAAGCAAGGCCAA
CACTGCGTCGAGACCATCCCTCAGAACATCGTTCCCTCCCGCTCGCGCTCCAAATCCAGAGCCTCATCTCCGCGA
CGAAGCCGTTCCCCCAAGCGAAAGTACACATCCCGATCCGAAGCAAGCCGCAGCCCCATCCGACGCCGAAGCCGC
AGCCGCAGCCGCAGCCCCCCCCGTCGCCGAACCGGCCCCAACACAAGCAGCAACTTCAGACGACGCAGTCCAGCC
CGTCACGATCGCAGAAACGCCTCGTACAGCCGCAGCCGCAGCCGCAGCCCGACTCCGCGCCGACGCAGAGACGCC
TCCTACAGCCGCAGCCGTAGTCCGGCTCCGCGGCGGGGCCGAACTGACCGTCGACGCTCCTACACCGAGTCCGCA
TCGCACGACTCTTCTCGATCGCGCTCCTACTCACACGGACAATCAAGACGTCCTCACCGACGCTCCTCTCGCTCC
GCCAGCCCTCCCTTCCGCGAAGGCCGCCCATACCGCGACCCCCAAGGCGATCACCGCTCCCACCAACCACCCACC
AACCCACCGCCTCACCCCCAAGGCACCACCGAAGCCTTTCCCGCTCCGCCCCCTCCGCCTCCCCTGCCGGAAAGT
ACCGAGATGACGGCTGCGCAGCGCGAGTTCCGCGCCCAGGAGGAGGCGCTCGAGCGGGAGAATGAGGAAGCGCAG
AGGCTCGAGGACGAGGGAAGGATGATGGAGGCGGCGACAAAGGGCGACTTGCGCAAGGATGTTATCCTCGCGGCG
TGA
Gene >Ophun1|5554
ATGAATACGGTGCGTGCAGATCTCCCGCCCCTCCTCTGCTACAGGCAACGTGAGCTCCGTCGCTAACCGCCTATC
GCGCCAGGTCCGATCTTTCTGGTGCGCCGCTCCGCCAGCCTCGCTACTCTCGCATCGCTGACGCTCTCCTGGATG
TAGGATTGGATGGGGCTCTCTTTGCGTCGGTAGGGCTCCTCGTTTCGTCCCGTCCCGTCCCGTTGTCTGCAACCT
GCTAAAGATGCACGTCCGTTACAGCCGGAGCCGGCGCGTACTACCTGGCCAAACGCGAGATCAACGCCGACCGCC
AGTCGAAGCTCGAACAGGCTCGCAAGAAGCAGCTTGAGACTCGGGCATTGGATCTGGGTGCTACCGCCGAGCACG
CGAGGACGGATAGCGCTGGCTCACCCAGCCAGGAGGCCTGCTCAGATCCCGCGCCGACGAGACATGCGCCGACGA
CCGAGTCCGAGCGAGTATCGGAAAAGAGCAAGTACGAGAGCAGCGTGCCGTACCGGAGACCGAAAGGCGATCGCT
TCTCTTGAGGGATGGAGGGTATCTGGAGGATGCGTGATGGATGTATGAACCTATATTTGTAGTCGACAGTGGATA
TGTTCTCAACACGGATATGAAAACTACTCTTCGCTCTATATTTCTTGCGACTGGACTATCGCCACTTCAGAACAT
CTGGCTCCTCGCTTTCGTTTCCTTTGGACGAACCTCTCGCCATCCTCCTACACCTCGACTCGCAGGCCCACTCAC
CAGCTCTTCCAGTCCAGCAAGGCTGCAGCTCGACCATTTAACCGAAACTTAGCCGCTCCACCAAAACTTCCGGCT
GCCATCCCAAATCTGCACCAAAAGCTTTCCACTTCTCTAACGGCAAGCTTCAGCTTCCTCCCCGTCGTCCATCTG
GCCGCGCCGCCACGCGACGGGACGCGTGTCTCCGACATCATGGTCGTGACGCCGGACCTTGCCGTTGCCAGATCC
AATCTTATAACCCTGCTGTCGCGCGCCGATCCTGAATCCTTGAGTCGGACAGCGGCTTTCGAATTTCTCGAGCTA
CTCGACAATACGCTCGATGAGTGTTCGCGGCCCAACGTTCAGGTAATCTTCCTTTCTGCTTTTTCTACGTTTCTT
TCTTTCTTGATTCTAGACCATGGCTAACGCGTAAGTCGAACAGAAATGCAAGAACTGGATCCTCGCCAACGTCGC
CCCCTCCGACGAACGAGCCTTTGCGCTGGGAAGATACCTCGTCGCCCTTTCAGAGAGCATGGAGAAGGACTTTGA
CCGTCCCAGCGTCCGACGTCGTCGTCTCCACGTTCTCTACATCGCCAGCGACGTCCTGTACCATGCCGTCATCTG
CCGCGACGACCAGCACCTCTCCCGCGCCTGGGAAGGCCATCTGCCGGCCATGATTGCGACGGCATCCACGTTTGA
GAAGTGTCCCAAGCACCTTTCCAAGGTCCGCGCCCTCATTGATCTTTGGGAAGAGAAGCGCTATCTGTACCCGGA
CGTGATTCTCAAACTCAGAGACTCCTTCACTCGCGCCTCCGACAAGGAGTCCGGCACTCGAATTCAGATGTCGTC
GGCTGCCCTTGAGCTCGCCAAGGAAGCGCCCTTCCTGATTCCTTCGACTCACGGCGAAGCTTCCGTGCCGTGGAA
CGACTTGCCCGCCGCGACTTGGCTTGCACAGCTGAAGCCCGGCTCAACACAGCTCATGCGCCGCAACCTGGTGCG
GCCCATCCAGCTCAACCAAGGTGCCGCGCCTCAGCCACTGGTCCAAGTGGTCAAAGATACGCTCCAAGAAGCCAA
AACTCTGTACGTCAAGGATCATCTTCGAGACAGGACAGGCCTCGACTTCAACCTCATGGGAGAAACTCAAACCCA
GCCCGGCACTCGCGAAGCCGCTACCTATTGGGGCTGGACGCCCAAGCTCTGCCGTCGCGTCAAGCAAGGCCAACA
CTGCGTCGAGACCATCCCTCAGAACATCGTTCCCTCCCGCTCGCGCTCCAAATCCAGAGCCTCATCTCCGCGACG
AAGCCGTTCCCCCAAGCGAAAGTACACATCCCGATCCGAAGCAAGCCGCAGCCCCATCCGACGCCGAAGCCGCAG
CCGCAGCCGCAGCCCCCCCCGTCGCCGAACCGGCCCCAACACAAGCAGCAACTTCAGACGACGCAGTCCAGCCCG
TCACGATCGCAGAAACGCCTCGTACAGCCGCAGCCGCAGCCGCAGCCCGACTCCGCGCCGACGCAGAGACGCCTC
CTACAGCCGCAGCCGTAGTCCGGCTCCGCGGCGGGGCCGAACTGACCGTCGACGCTCCTACACCGAGTCCGCATC
GCACGACTCTTCTCGATCGCGCTCCTACTCACACGGACAATCAAGACGTCCTCACCGACGCTCCTCTCGCTCCGC
CAGCCCTCCCTTCCGCGAAGGCCGCCCATACCGCGACCCCCAAGGCGATCACCGCTCCCACCAACCACCCACCAA
CCCACCGCCTCACCCCCAAGGCACCACCGAAGCCTTTCCCGCTCCGCCCCCTCCGCCTCCCCTGCCGGAAAGTAC
CGAGATGACGGCTGCGCAGCGCGAGTTCCGCGCCCAGGAGGAGGCGCTCGAGCGGGAGAATGAGGAAGCGCAGAG
GCTCGAGGACGAGGGAAGGATGATGGAGGCGGCGACAAAGGGCGACTTGCGCAAGGATGTTATCCTCGCGGCGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail