Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5553
Gene name
LocationContig_555:4555..8138
Strand-
Gene length (bp)3583
Transcript length (bp)3450
Coding sequence length (bp)3450
Protein length (aa) 1150

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 1.4E-07 753 1072

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 399 1133 4.0E-180
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 729 1123 2.0E-45
sp|Q0WT19|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8 OS=Arabidopsis thaliana GN=IP5P8 PE=2 SV=1 747 1079 1.0E-44
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 741 1097 7.0E-43
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 733 1097 9.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 399 1133 4.0E-180
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 729 1123 2.0E-45
sp|Q0WT19|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8 OS=Arabidopsis thaliana GN=IP5P8 PE=2 SV=1 747 1079 1.0E-44
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 741 1097 7.0E-43
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 733 1097 9.0E-43
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 733 1097 1.0E-42
sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 735 1105 1.0E-42
sp|Q0WQ41|IP5P7_ARATH Type IV inositol polyphosphate 5-phosphatase 7 OS=Arabidopsis thaliana GN=IP5P7 PE=1 SV=1 847 1079 2.0E-42
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 735 1075 3.0E-42
sp|Q9LR47|IP5P6_ARATH Type IV inositol polyphosphate 5-phosphatase 6 OS=Arabidopsis thaliana GN=IP5P6 PE=1 SV=2 847 1079 6.0E-42
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 735 1075 7.0E-42
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 705 1075 1.0E-41
sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=1 SV=1 735 1089 2.0E-41
sp|Q9JMC1|PI5PA_RAT Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Rattus norvegicus GN=Inpp5j PE=1 SV=1 748 1081 4.0E-41
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 747 1097 5.0E-41
sp|Q15735|PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens GN=INPP5J PE=1 SV=3 748 1081 7.0E-41
sp|P59644|PI5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus GN=Inpp5j PE=1 SV=2 748 1081 9.0E-41
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 785 1091 1.0E-40
sp|Q01968|OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3 735 1089 1.0E-40
sp|Q8GTS0|IP5P4_ARATH Type I inositol polyphosphate 5-phosphatase 4 OS=Arabidopsis thaliana GN=IP5P4 PE=2 SV=1 847 1079 7.0E-40
sp|Q8K337|I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus GN=Inpp5b PE=1 SV=1 726 1087 9.0E-40
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 785 1091 4.0E-39
sp|Q9SIS4|IP5P9_ARATH Type IV inositol polyphosphate 5-phosphatase 9 OS=Arabidopsis thaliana GN=IP5P9 PE=1 SV=1 749 1118 2.0E-38
sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 726 1087 1.0E-37
sp|Q8H0Z6|IP5P3_ARATH Type IV inositol polyphosphate 5-phosphatase 3 OS=Arabidopsis thaliana GN=IP5P3 PE=1 SV=1 847 1104 1.0E-37
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 847 1135 1.0E-37
sp|Q66GQ6|IP5P5_ARATH Type I inositol polyphosphate 5-phosphatase 5 OS=Arabidopsis thaliana GN=IP5P5 PE=2 SV=1 841 1079 4.0E-37
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 638 1087 5.0E-37
sp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=IP5P12 PE=1 SV=2 657 1087 2.0E-35
sp|A8MR21|IP5PA_ARATH Type I inositol polyphosphate 5-phosphatase 10 OS=Arabidopsis thaliana GN=IP5P10 PE=2 SV=1 847 1079 6.0E-35
sp|Q84MA2|IP5P1_ARATH Type I inositol polyphosphate 5-phosphatase 1 OS=Arabidopsis thaliana GN=IP5P1 PE=1 SV=2 847 1079 4.0E-34
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 847 1089 3.0E-33
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 823 1083 6.0E-32
sp|Q9SYK4|IP5PD_ARATH Type I inositol polyphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=IP5P13 PE=1 SV=1 657 1087 3.0E-30
sp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=IP5P14 PE=1 SV=1 657 1052 1.0E-29
sp|Q8C5L6|INP5K_MOUSE Inositol polyphosphate 5-phosphatase K OS=Mus musculus GN=Inpp5k PE=1 SV=2 748 1081 3.0E-28
sp|Q9BT40|INP5K_HUMAN Inositol polyphosphate 5-phosphatase K OS=Homo sapiens GN=INPP5K PE=1 SV=3 748 1084 4.0E-27
sp|Q92835|SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens GN=INPP5D PE=1 SV=2 816 1106 6.0E-27
sp|O15357|SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens GN=INPPL1 PE=1 SV=2 731 1105 5.0E-26
sp|Q6P549|SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus GN=Inppl1 PE=1 SV=1 827 1105 2.0E-25
sp|Q9WVR3|SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus GN=Inppl1 PE=1 SV=1 731 1105 2.0E-25
sp|Q2I6J1|SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio GN=inppl1a PE=2 SV=2 827 1105 3.0E-25
sp|P97573|SHIP1_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Rattus norvegicus GN=Inpp5d PE=1 SV=1 827 1083 6.0E-24
sp|Q9ES52|SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus GN=Inpp5d PE=1 SV=2 827 1083 1.0E-23
sp|Q2I6J0|SHP2B_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2B OS=Danio rerio GN=inppl1b PE=2 SV=1 827 1083 2.0E-23
sp|Q5EAF2|IP5PB_ARATH Type IV inositol polyphosphate 5-phosphatase 11 OS=Arabidopsis thaliana GN=IP5P11 PE=1 SV=1 883 1083 5.0E-23
sp|Q9NRR6|INP5E_HUMAN 72 kDa inositol polyphosphate 5-phosphatase OS=Homo sapiens GN=INPP5E PE=1 SV=2 827 1084 6.0E-23
sp|Q9JII1|INP5E_MOUSE 72 kDa inositol polyphosphate 5-phosphatase OS=Mus musculus GN=Inpp5e PE=1 SV=1 827 1084 1.0E-22
sp|A0FI79|INP5E_PANTR 72 kDa inositol polyphosphate 5-phosphatase OS=Pan troglodytes GN=INPP5E PE=2 SV=1 827 1084 2.0E-22
sp|Q9WVR1|INP5E_RAT 72 kDa inositol polyphosphate 5-phosphatase OS=Rattus norvegicus GN=Inpp5e PE=1 SV=2 827 1084 5.0E-22
sp|Q6P4S2|SHIP1_XENLA Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Xenopus laevis GN=inpp5d PE=2 SV=1 816 1083 7.0E-22
sp|P34370|I5P2_CAEEL Inositol polyphosphate 5-phosphatase OS=Caenorhabditis elegans GN=cil-1 PE=1 SV=1 862 1081 2.0E-14
sp|Q08227|INP54_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP54 PE=1 SV=1 749 1081 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4379
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5401
Ophiocordyceps australis map64 (Brazil) OphauB2|1867
Ophiocordyceps camponoti-floridani Ophcf2|03503
Ophiocordyceps camponoti-rufipedis Ophun1|5553 (this protein)
Ophiocordyceps kimflemingae Ophio5|7542
Ophiocordyceps subramaniannii Hirsu2|9058

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5553
MDHSPAQDGPDGSSIKPVSSLLARFENMNTGSQQHEQSRSLSPAPKPERLRNFKPAGHDPPKTPARPPVRPPERL
VAERTGNSRPPSGPSPTIKPLGLALQPPAVMIQPPPSSPDSAPSVADHHSPFLDPDPEPSHDGIPAPPKATKMPT
PSTSPFAPSIKPPRPSLSNPPSPPPPRRSVDTRREFKQAPPPPPAPRSSRGRPTSNLPEARDGAPSKADISQAVS
PFNSPPGSPTQGHVEPFRELPTRLTAKSKADGSGLEAPPPRPSTASRPTTATSSARSHGPSPRTADLRLTPDSSR
FRGAPDHEDAASKPPQTTPLTNSHKFEPPPPPPERPVSQPAPRQVPPPPTRQTKDSRTRDRTPNGEGPEIRRSSS
PNTAASSGHPAVAPAAEAGSKTTAFPDGSNSNRRPPFIRKGCSEIQTRYDARALDSCGELVCTSGQLTRVWNLVD
GEQIMSLAHTEGVRATSVAFKPAPSADTEGSTLWIGTNLGEIMEVDVASQRVVHSKAGLHGRCDVMRIYRHVNEL
WTLDDMGLLLTWGPGADGVPSLASHPHQSNKVPRGHTFSMVVGNELWHATGKAIRVFAPSFDRSGPFQVLVRPLT
FEGAGDVTAGTLMRTQPNKAFLGHIDGKVSIFSTEDYSCLAVLSISSWKINALAGVGQHLWAGYNTGKMCVYDMS
TSPWTVRKDWQGHDQSIIKMAADPAAAYRLDRLQVVSLGTDNKIKAWDGLMQDDWLEEDMKSKDIEYCDFDELRA
TVMTWNAGASTPHSLRYSDSDSSFFQDLVRSSGSPDMFIFGFQELVDLEDKTATARRFLKGKKKEGTDQERMSHQ
YRDWRDFLIKTLDDYVPADNLYHLLQSAPLVGLFTCVFVKASLRERIRNVCAAEVKRGMGGLHGNKGAVVVRFQV
DDTSLCFINCHLAAGQSQSSSRHNDVAAILDTTLFPAERDAEARIDSFAGGGDGTMIMDHELCVLNGDLNYRIDT
MSRDTVVKAVSQGNLAKLLERDQLLMARRRNPAFRLRAFEEMAITFAPTYKYDVGTDTYDTSEKRRSPAWCDRLL
CRGRGRIQQLDYQRHEVRVSDHRPVTGSFRLWVKKVDARGRAVAWMESQQRFEDVRQRETDDEQISYLVNTCGYD
EESSDKFVRERSGRKGSTRRGSGH*
Coding >Ophun1|5553
ATGGACCATTCTCCTGCCCAAGACGGGCCTGATGGCTCCTCCATTAAGCCCGTATCGTCACTCCTCGCTCGCTTC
GAGAACATGAATACGGGGTCGCAGCAGCACGAACAGTCGCGTTCCCTTTCCCCGGCTCCGAAGCCCGAGAGGCTG
CGCAACTTCAAGCCCGCCGGACACGATCCCCCCAAGACGCCTGCCAGGCCCCCTGTCAGGCCTCCGGAACGCCTC
GTTGCCGAACGAACAGGCAATTCGCGGCCCCCATCTGGACCCTCACCGACGATCAAGCCGCTGGGCCTCGCTCTT
CAGCCGCCCGCTGTCATGATCCAGCCTCCGCCCTCTTCCCCCGATAGCGCGCCGTCGGTCGCCGATCACCACTCT
CCCTTCCTGGACCCCGACCCTGAGCCGAGCCACGACGGCATTCCCGCGCCGCCCAAAGCGACCAAGATGCCTACT
CCGTCTACGAGCCCTTTCGCACCATCCATCAAGCCTCCTCGTCCAAGCCTATCGAACCCGCCGTCGCCACCTCCG
CCGCGGCGATCCGTCGACACGAGGAGGGAGTTCAAGCAGGCTCCGCCGCCGCCGCCAGCTCCACGGTCCAGTCGA
GGACGTCCGACCTCGAACCTTCCCGAAGCCCGCGATGGTGCGCCGTCCAAGGCCGATATCTCTCAGGCCGTCTCT
CCCTTCAACAGCCCCCCTGGCAGCCCCACGCAGGGCCACGTCGAGCCTTTTCGAGAATTACCGACGCGGCTCACC
GCAAAGTCCAAAGCGGACGGTTCAGGGCTCGAAGCTCCGCCGCCACGGCCATCCACCGCGTCCAGGCCGACAACG
GCCACTTCCTCGGCAAGATCACATGGGCCCTCCCCGCGCACTGCCGACCTTCGCCTCACTCCCGACTCCAGCCGC
TTCAGAGGCGCCCCAGACCACGAAGATGCCGCCTCGAAACCTCCGCAGACGACTCCCCTTACCAACAGCCACAAG
TTCGAGCCGCCGCCGCCGCCGCCAGAGCGCCCCGTCTCTCAGCCCGCGCCCCGTCAGGTGCCACCTCCTCCGACT
CGGCAGACGAAAGACTCCCGGACGAGAGATCGAACACCCAACGGAGAGGGGCCGGAAATCAGGAGAAGCTCATCT
CCCAATACGGCAGCCTCTTCCGGGCATCCCGCCGTCGCTCCGGCAGCCGAAGCCGGCAGCAAAACGACGGCGTTC
CCCGACGGGTCCAACTCCAATCGGCGGCCGCCTTTCATCAGGAAGGGATGCAGCGAGATACAAACGCGTTACGAC
GCGCGAGCCTTGGACTCATGCGGGGAGCTGGTGTGCACCAGTGGCCAGCTGACGCGTGTCTGGAACCTCGTCGAT
GGCGAGCAGATCATGAGTCTGGCTCACACCGAGGGCGTCAGGGCCACCTCGGTCGCCTTCAAACCCGCGCCGAGC
GCCGACACGGAGGGATCGACGCTGTGGATCGGCACCAACCTGGGCGAGATTATGGAGGTGGACGTCGCGTCGCAA
CGGGTGGTCCACAGCAAGGCCGGCCTGCACGGGCGCTGTGACGTGATGCGCATCTACCGCCATGTCAACGAGCTC
TGGACCCTGGACGACATGGGCTTGCTGCTCACATGGGGACCTGGAGCCGACGGAGTGCCGAGCCTGGCTAGCCAT
CCGCATCAGAGCAACAAGGTGCCGAGGGGCCATACCTTTTCCATGGTGGTGGGCAACGAGCTTTGGCACGCCACA
GGAAAGGCCATCCGCGTCTTCGCGCCCTCATTCGACCGAAGCGGGCCCTTTCAAGTGCTGGTCCGCCCGCTGACG
TTTGAGGGCGCGGGCGACGTGACGGCCGGTACCTTGATGCGGACGCAACCGAACAAGGCTTTCCTGGGTCACATC
GACGGCAAGGTCAGCATCTTCTCGACAGAGGACTACTCGTGTCTGGCGGTGCTGAGCATCAGCTCGTGGAAGATC
AACGCCCTCGCCGGAGTGGGACAACACCTCTGGGCCGGATACAACACGGGCAAAATGTGCGTCTACGATATGAGC
ACAAGCCCATGGACGGTCCGCAAGGACTGGCAAGGCCATGATCAGTCCATCATCAAGATGGCGGCCGATCCGGCG
GCGGCGTACCGGCTCGACCGGCTACAGGTCGTCTCGCTCGGGACCGACAACAAGATCAAGGCGTGGGACGGGCTG
ATGCAGGACGACTGGCTCGAGGAGGACATGAAGTCCAAGGACATCGAGTACTGCGACTTTGATGAGCTCCGGGCC
ACGGTCATGACGTGGAACGCGGGCGCGTCGACGCCTCACAGCCTGCGGTATTCGGACTCGGACTCTTCCTTCTTC
CAAGACCTGGTTCGGTCGAGCGGATCGCCAGACATGTTCATCTTTGGCTTCCAGGAGCTCGTCGATCTCGAAGAC
AAGACGGCCACGGCCCGGCGCTTCCTCAAGGGCAAGAAGAAGGAGGGGACGGACCAGGAACGGATGAGCCACCAA
TACCGCGATTGGCGCGACTTTCTCATCAAGACGCTCGACGACTACGTGCCGGCAGATAACCTGTACCACCTTCTG
CAGTCGGCGCCGCTCGTCGGCCTGTTTACGTGCGTCTTCGTCAAGGCGTCGTTGCGGGAGAGGATCCGCAACGTG
TGCGCGGCCGAGGTCAAGCGCGGCATGGGCGGCCTGCACGGGAACAAGGGAGCGGTGGTGGTGCGCTTCCAGGTG
GACGACACGTCGCTCTGCTTCATCAACTGCCATCTGGCGGCCGGTCAGTCGCAGTCGAGCTCGCGGCACAACGAC
GTGGCGGCCATCCTCGACACGACGCTGTTCCCGGCCGAGCGCGACGCCGAAGCACGCATCGACAGCTTCGCGGGA
GGCGGCGACGGCACCATGATTATGGATCACGAGCTGTGCGTGCTCAACGGCGACCTCAACTACCGAATCGACACC
ATGTCGCGCGACACCGTCGTCAAGGCCGTCTCACAAGGCAATCTGGCCAAACTGCTGGAGCGCGACCAGCTGCTC
ATGGCGCGGCGGCGCAACCCAGCCTTTCGGCTCCGGGCCTTTGAAGAGATGGCCATTACTTTCGCGCCCACGTAC
AAGTATGACGTCGGCACCGACACCTACGACACGAGCGAGAAGCGGCGCAGCCCAGCCTGGTGCGACCGCCTGCTG
TGCCGGGGCCGGGGCCGCATACAGCAGCTCGACTACCAACGGCACGAGGTCAGGGTCAGCGACCATCGACCCGTG
ACGGGGAGCTTCCGGCTATGGGTCAAGAAGGTGGACGCCAGGGGGAGGGCGGTGGCGTGGATGGAGAGCCAGCAG
AGATTCGAGGACGTGCGGCAGCGGGAGACTGATGACGAGCAAATCTCCTACTTGGTCAACACGTGCGGCTATGAC
GAGGAGTCGAGCGACAAGTTTGTGCGGGAGAGGTCGGGCAGAAAGGGATCGACCAGACGGGGAAGCGGCCATTGA
Transcript >Ophun1|5553
ATGGACCATTCTCCTGCCCAAGACGGGCCTGATGGCTCCTCCATTAAGCCCGTATCGTCACTCCTCGCTCGCTTC
GAGAACATGAATACGGGGTCGCAGCAGCACGAACAGTCGCGTTCCCTTTCCCCGGCTCCGAAGCCCGAGAGGCTG
CGCAACTTCAAGCCCGCCGGACACGATCCCCCCAAGACGCCTGCCAGGCCCCCTGTCAGGCCTCCGGAACGCCTC
GTTGCCGAACGAACAGGCAATTCGCGGCCCCCATCTGGACCCTCACCGACGATCAAGCCGCTGGGCCTCGCTCTT
CAGCCGCCCGCTGTCATGATCCAGCCTCCGCCCTCTTCCCCCGATAGCGCGCCGTCGGTCGCCGATCACCACTCT
CCCTTCCTGGACCCCGACCCTGAGCCGAGCCACGACGGCATTCCCGCGCCGCCCAAAGCGACCAAGATGCCTACT
CCGTCTACGAGCCCTTTCGCACCATCCATCAAGCCTCCTCGTCCAAGCCTATCGAACCCGCCGTCGCCACCTCCG
CCGCGGCGATCCGTCGACACGAGGAGGGAGTTCAAGCAGGCTCCGCCGCCGCCGCCAGCTCCACGGTCCAGTCGA
GGACGTCCGACCTCGAACCTTCCCGAAGCCCGCGATGGTGCGCCGTCCAAGGCCGATATCTCTCAGGCCGTCTCT
CCCTTCAACAGCCCCCCTGGCAGCCCCACGCAGGGCCACGTCGAGCCTTTTCGAGAATTACCGACGCGGCTCACC
GCAAAGTCCAAAGCGGACGGTTCAGGGCTCGAAGCTCCGCCGCCACGGCCATCCACCGCGTCCAGGCCGACAACG
GCCACTTCCTCGGCAAGATCACATGGGCCCTCCCCGCGCACTGCCGACCTTCGCCTCACTCCCGACTCCAGCCGC
TTCAGAGGCGCCCCAGACCACGAAGATGCCGCCTCGAAACCTCCGCAGACGACTCCCCTTACCAACAGCCACAAG
TTCGAGCCGCCGCCGCCGCCGCCAGAGCGCCCCGTCTCTCAGCCCGCGCCCCGTCAGGTGCCACCTCCTCCGACT
CGGCAGACGAAAGACTCCCGGACGAGAGATCGAACACCCAACGGAGAGGGGCCGGAAATCAGGAGAAGCTCATCT
CCCAATACGGCAGCCTCTTCCGGGCATCCCGCCGTCGCTCCGGCAGCCGAAGCCGGCAGCAAAACGACGGCGTTC
CCCGACGGGTCCAACTCCAATCGGCGGCCGCCTTTCATCAGGAAGGGATGCAGCGAGATACAAACGCGTTACGAC
GCGCGAGCCTTGGACTCATGCGGGGAGCTGGTGTGCACCAGTGGCCAGCTGACGCGTGTCTGGAACCTCGTCGAT
GGCGAGCAGATCATGAGTCTGGCTCACACCGAGGGCGTCAGGGCCACCTCGGTCGCCTTCAAACCCGCGCCGAGC
GCCGACACGGAGGGATCGACGCTGTGGATCGGCACCAACCTGGGCGAGATTATGGAGGTGGACGTCGCGTCGCAA
CGGGTGGTCCACAGCAAGGCCGGCCTGCACGGGCGCTGTGACGTGATGCGCATCTACCGCCATGTCAACGAGCTC
TGGACCCTGGACGACATGGGCTTGCTGCTCACATGGGGACCTGGAGCCGACGGAGTGCCGAGCCTGGCTAGCCAT
CCGCATCAGAGCAACAAGGTGCCGAGGGGCCATACCTTTTCCATGGTGGTGGGCAACGAGCTTTGGCACGCCACA
GGAAAGGCCATCCGCGTCTTCGCGCCCTCATTCGACCGAAGCGGGCCCTTTCAAGTGCTGGTCCGCCCGCTGACG
TTTGAGGGCGCGGGCGACGTGACGGCCGGTACCTTGATGCGGACGCAACCGAACAAGGCTTTCCTGGGTCACATC
GACGGCAAGGTCAGCATCTTCTCGACAGAGGACTACTCGTGTCTGGCGGTGCTGAGCATCAGCTCGTGGAAGATC
AACGCCCTCGCCGGAGTGGGACAACACCTCTGGGCCGGATACAACACGGGCAAAATGTGCGTCTACGATATGAGC
ACAAGCCCATGGACGGTCCGCAAGGACTGGCAAGGCCATGATCAGTCCATCATCAAGATGGCGGCCGATCCGGCG
GCGGCGTACCGGCTCGACCGGCTACAGGTCGTCTCGCTCGGGACCGACAACAAGATCAAGGCGTGGGACGGGCTG
ATGCAGGACGACTGGCTCGAGGAGGACATGAAGTCCAAGGACATCGAGTACTGCGACTTTGATGAGCTCCGGGCC
ACGGTCATGACGTGGAACGCGGGCGCGTCGACGCCTCACAGCCTGCGGTATTCGGACTCGGACTCTTCCTTCTTC
CAAGACCTGGTTCGGTCGAGCGGATCGCCAGACATGTTCATCTTTGGCTTCCAGGAGCTCGTCGATCTCGAAGAC
AAGACGGCCACGGCCCGGCGCTTCCTCAAGGGCAAGAAGAAGGAGGGGACGGACCAGGAACGGATGAGCCACCAA
TACCGCGATTGGCGCGACTTTCTCATCAAGACGCTCGACGACTACGTGCCGGCAGATAACCTGTACCACCTTCTG
CAGTCGGCGCCGCTCGTCGGCCTGTTTACGTGCGTCTTCGTCAAGGCGTCGTTGCGGGAGAGGATCCGCAACGTG
TGCGCGGCCGAGGTCAAGCGCGGCATGGGCGGCCTGCACGGGAACAAGGGAGCGGTGGTGGTGCGCTTCCAGGTG
GACGACACGTCGCTCTGCTTCATCAACTGCCATCTGGCGGCCGGTCAGTCGCAGTCGAGCTCGCGGCACAACGAC
GTGGCGGCCATCCTCGACACGACGCTGTTCCCGGCCGAGCGCGACGCCGAAGCACGCATCGACAGCTTCGCGGGA
GGCGGCGACGGCACCATGATTATGGATCACGAGCTGTGCGTGCTCAACGGCGACCTCAACTACCGAATCGACACC
ATGTCGCGCGACACCGTCGTCAAGGCCGTCTCACAAGGCAATCTGGCCAAACTGCTGGAGCGCGACCAGCTGCTC
ATGGCGCGGCGGCGCAACCCAGCCTTTCGGCTCCGGGCCTTTGAAGAGATGGCCATTACTTTCGCGCCCACGTAC
AAGTATGACGTCGGCACCGACACCTACGACACGAGCGAGAAGCGGCGCAGCCCAGCCTGGTGCGACCGCCTGCTG
TGCCGGGGCCGGGGCCGCATACAGCAGCTCGACTACCAACGGCACGAGGTCAGGGTCAGCGACCATCGACCCGTG
ACGGGGAGCTTCCGGCTATGGGTCAAGAAGGTGGACGCCAGGGGGAGGGCGGTGGCGTGGATGGAGAGCCAGCAG
AGATTCGAGGACGTGCGGCAGCGGGAGACTGATGACGAGCAAATCTCCTACTTGGTCAACACGTGCGGCTATGAC
GAGGAGTCGAGCGACAAGTTTGTGCGGGAGAGGTCGGGCAGAAAGGGATCGACCAGACGGGGAAGCGGCCATTGA
Gene >Ophun1|5553
ATGGACCATTCTCCTGCCCAAGACGGGCCTGATGGCTCCTCCATTGTCCGTGGCCCCCGCTCCTTTACCCCCGCC
TCCGATTCTTGACGCGTGTCTCTGACTATTCGCAGAAGCCCGTATCGTCACTCCTCGCTCGCTTCGAGAACATGA
ATACGGGGTCGCAGCAGCACGAACAGTCGCGTTCCCTTTCCCCGGCTCCGAAGCCCGAGAGGCTGCGCAACTTCA
AGCCCGCCGGACACGATCCCCCCAAGACGCCTGCCAGGCCCCCTGTCAGGCCTCCGGAACGCCTCGTTGCCGAAC
GAACAGGCAATTCGCGGCCCCCATCTGGACCCTCACCGACGATCAAGCCGCTGGGCCTCGCTCTTCAGCCGCCCG
CTGTCATGATCCAGCCTCCGCCCTCTTCCCCCGATAGCGCGCCGTCGGTCGCCGATCACCACTCTCCCTTCCTGG
ACCCCGACCCTGAGCCGAGCCACGACGGCATTCCCGCGCCGCCCAAAGCGACCAAGATGCCTACTCCGTCTACGA
GCCCTTTCGCACCATCCATCAAGCCTCCTCGTCCAAGCCTATCGAACCCGCCGTCGCCACCTCCGCCGCGGCGAT
CCGTCGACACGAGGAGGGAGTTCAAGCAGGCTCCGCCGCCGCCGCCAGCTCCACGGTCCAGTCGAGGACGTCCGA
CCTCGAACCTTCCCGAAGCCCGCGATGGTGCGCCGTCCAAGGCCGATATCTCTCAGGCCGTCTCTCCCTTCAACA
GCCCCCCTGGCAGCCCCACGCAGGGCCACGTCGAGCCTTTTCGAGAATTACCGACGCGGCTCACCGCAAAGTCCA
AAGCGGACGGTTCAGGGCTCGAAGCTCCGCCGCCACGGCCATCCACCGCGTCCAGGCCGACAACGGCCACTTCCT
CGGCAAGATCACATGGGCCCTCCCCGCGCACTGCCGACCTTCGCCTCACTCCCGACTCCAGCCGCTTCAGAGGCG
CCCCAGACCACGAAGATGCCGCCTCGAAACCTCCGCAGACGACTCCCCTTACCAACAGCCACAAGTTCGAGCCGC
CGCCGCCGCCGCCAGAGCGCCCCGTCTCTCAGCCCGCGCCCCGTCAGGTGCCACCTCCTCCGACTCGGCAGACGA
AAGACTCCCGGACGAGAGATCGAACACCCAACGGAGAGGGGCCGGAAATCAGGAGAAGCTCATCTCCCAATACGG
CAGCCTCTTCCGGGCATCCCGCCGTCGCTCCGGCAGCCGAAGCCGGCAGCAAAACGACGGCGTTCCCCGACGGGT
CCAACTCCAATCGGCGGCCGCCTTTCATCAGGAAGGGATGCAGCGAGATACAAACGCGTTACGACGCGCGAGCCT
TGGACTCATGCGGGGAGCTGGTGTGCACCAGTGGCCAGCTGACGCGTGTCTGGAACCTCGTCGATGGCGAGCAGA
TCATGAGTCTGGCTCACACCGAGGGCGTCAGGGCCACCTCGGTCGCCTTCAAACCCGCGCCGAGCGCCGACACGG
AGGGATCGACGCTGTGGATCGGCACCAACCTGGGCGAGATTATGGAGGTGGACGTCGCGTCGCAACGGGTGGTCC
ACAGCAAGGCCGGCCTGCACGGGCGCTGTGACGTGATGCGCATCTACCGCCATGTCAACGAGCTCTGGACCCTGG
ACGACATGGGCTTGCTGCTCACATGGGGACCTGGAGCCGACGGAGTGCCGAGCCTGGCTAGCCATCCGCATCAGA
GCAACAAGGTGCCGAGGGGCCATACCTTTTCCATGGTGGTGGGCAACGAGCTTTGGCACGCCACAGGAAAGGCCA
TCCGCGTCTTCGCGCCCTCATTCGACCGAAGCGGGCCCTTTCAAGTGCTGGTCCGCCCGCTGACGTTTGAGGGCG
CGGGCGACGTGACGGCCGGTACCTTGATGCGGACGCAACCGAACAAGGCTTTCCTGGGTCACATCGACGGCAAGG
TCAGCATCTTCTCGACAGAGGACTACTCGTGTCTGGCGGTGCTGAGCATCAGCTCGTGGAAGATCAACGCCCTCG
CCGGAGTGGGACAACACCTCTGGGCCGGATACAACACGGGCAAAATGTGCGTCTACGATATGAGCACAAGCCCAT
GGACGGTCCGCAAGGACTGGCAAGGCCATGATCAGTCCATCATCAAGATGGCGGCCGATCCGGCGGCGGCGTACC
GGCTCGACCGGCTACAGGTCGTCTCGCTCGGGACCGACAACAAGATCAAGGCGTGGGACGGGCTGATGCAGGACG
ACTGGCTCGAGGAGGACATGAAGTCCAAGGACATCGAGTACTGCGACTTTGATGAGCTCCGGGCCACGGTCATGA
CGTGGAACGCGGGCGCGTCGACGCCTCACAGCCTGCGGTATTCGGACTCGGACTCTTCCTTCTTCCAAGACCTGG
TTCGGTCGAGCGGATCGCCAGACATGTTCATCTTTGGCTTCCAGGAGCTCGTCGATCTCGAAGACAAGACGGCCA
CGGCCCGGCGCTTCCTCAAGGGCAAGAAGAAGGAGGGGACGGACCAGGAACGGATGAGCCACCAATACCGCGATT
GGCGCGACTTTCTCATCAAGACGCTCGACGACTACGTGCCGGCAGATAACCTGTACCACCTTCTGCAGTCGGCGC
CGCTCGTCGGCCTGTTTACGTGCGTCTTCGTCAAGGCGTCGTTGCGGGAGAGGATCCGCAACGTGTGCGCGGCCG
AGGTCAAGCGCGGCATGGGCGGCCTGCACGGGAACAAGGGAGCGGTGGTGGTGCGCTTCCAGGTGGACGACACGT
CGCTCTGCTTCATCAACTGCCATCTGGCGGCCGGTCAGTCGCAGTCGAGCTCGCGGCACAACGACGTGGCGGCCA
TCCTCGACACGACGCTGTTCCCGGCCGAGCGCGACGCCGAAGCACGCATCGACAGCTTCGCGGGAGGCGGCGACG
GCACCATGATTATGGATCACGAGCTGTGCGTGCTCAACGGCGACCTCAACTACCGAATCGACACCATGTCGCGCG
ACACCGTCGTCAAGGCCGTCTCACAAGGCAATCTGGCCAAACTGCTGGAGCGCGACCAGCTGCTCATGGCGCGGC
GGCGCAACCCAGCCTTTCGGCTCCGGGCCTTTGAAGAGATGGCCATTACTTTCGCGCCCACGTACAAGTATGACG
TCGGCACCGACACCTACGACACGAGCGAGAAGCGGCGCAGCCCAGCCTGGTGCGACCGCCTGCTGTGCCGGGGCC
GGGGCCGCATACAGCAGCTCGACTACCAACGGCACGAGGTCAGGGTCAGCGACCATCGACCCGTGACGGGGAGCT
TCCGGCTATGGGTCAAGAAGGTGGACGCCAGGGGGAGGGCGGTGGCGTGGATGGAGAGCCAGCAGAGATTCGAGG
ACGTGCGGCAGCGGGAGACTGATGACGAGCAGTGAGTTTTTCCCTTCAGTCTCTGTATTACGCTTTGTGAGCAAG
GCTGATGATGATTTCTCTCTACAGAATCTCCTACTTGGTCAACACGTGCGGCTATGACGAGGAGTCGAGCGACAA
GTTTGTGCGGGAGAGGTCGGGCAGAAAGGGATCGACCAGACGGGGAAGCGGCCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail