Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5552
Gene name
LocationContig_555:2994..4152
Strand-
Gene length (bp)1158
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 3.5E-37 131 275
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 8.7E-15 66 107

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 12 322 2.0E-96
sp|P53860|PDR16_YEAST Phosphatidylinositol transfer protein PDR16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR16 PE=1 SV=1 5 331 4.0E-90
sp|P53844|PDR17_YEAST Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR17 PE=1 SV=1 28 325 5.0E-69
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 88 304 4.0E-17
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 83 275 8.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU99|YJX4_SCHPO CRAL-TRIO domain-containing protein C23B6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.04c PE=1 SV=1 12 322 2.0E-96
sp|P53860|PDR16_YEAST Phosphatidylinositol transfer protein PDR16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR16 PE=1 SV=1 5 331 4.0E-90
sp|P53844|PDR17_YEAST Phosphatidylinositol transfer protein PDR17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR17 PE=1 SV=1 28 325 5.0E-69
sp|Q10138|YAS2_SCHPO CRAL-TRIO domain-containing protein C3H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H8.02 PE=1 SV=1 88 304 4.0E-17
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 83 275 8.0E-17
sp|Q55CU8|RSC5_DICDI Random slug protein 5 OS=Dictyostelium discoideum GN=rsc5 PE=2 SV=1 66 286 2.0E-16
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 83 275 9.0E-16
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 88 282 3.0E-15
sp|Q56Z59|PATL3_ARATH Patellin-3 OS=Arabidopsis thaliana GN=PATL3 PE=1 SV=2 87 308 4.0E-15
sp|Q9M0R2|PATL5_ARATH Patellin-5 OS=Arabidopsis thaliana GN=PATL5 PE=1 SV=2 87 310 8.0E-15
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 88 278 3.0E-14
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 83 278 5.0E-14
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 83 268 2.0E-13
sp|Q94C59|PATL4_ARATH Patellin-4 OS=Arabidopsis thaliana GN=PATL4 PE=1 SV=2 87 285 8.0E-13
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 88 253 1.0E-12
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 83 275 1.0E-12
sp|Q9SCU1|PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana GN=PATL6 PE=2 SV=1 87 275 4.0E-12
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 87 268 5.0E-12
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 86 268 1.0E-10
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 84 255 1.0E-10
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 86 253 2.0E-10
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 88 253 4.0E-10
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 87 285 7.0E-10
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 86 255 1.0E-09
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 84 255 8.0E-09
sp|P12271|RLBP1_HUMAN Retinaldehyde-binding protein 1 OS=Homo sapiens GN=RLBP1 PE=1 SV=2 88 277 1.0E-08
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 86 253 7.0E-08
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 86 253 9.0E-08
sp|Q56ZI2|PATL2_ARATH Patellin-2 OS=Arabidopsis thaliana GN=PATL2 PE=1 SV=2 74 275 1.0E-07
sp|Q9HDZ5|YKP9_SCHPO CRAL-TRIO domain-containing protein C589.09, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.09 PE=3 SV=1 88 263 3.0E-06
sp|Q7S4C1|SFH5_NEUCR Phosphatidylinositol transfer protein sfh-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sfh-5 PE=3 SV=1 1 253 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5552
MEPTESPPRKTPLEEPLPDCKPAPSATLTAEQETKYEALLGRAKALDEIRCDKDKEKAKAKGGKSEEEKSKSGPV
TEAERRWLTRECLLRYLRATKWNVDDAAKRLVSTLAWRREYGIDEFTAEYISPEQETGKQMIVGFDRVGRPCLYL
NPGRQNTDASPRQLHHMFYMMERVMELMPAGVETLSLLINFKPTKKRQNTSVPVMTAREVLHILQNHYPERLGKA
LIINVPWVVSGFFKVITPFIDPVTRDKLKFNEDMRLYVPPEQLWSADWGGDMDFEYEHATYWPALHELCRARREL
RIKRWEAAGGIIGESEVYLAGGTDESVGGVRYRGDGDGEVDAVEEKMAAVQVGGGGVAEVAGEV*
Coding >Ophun1|5552
ATGGAGCCAACGGAGAGCCCGCCACGGAAGACGCCGCTGGAAGAGCCGTTGCCAGATTGCAAACCTGCGCCCAGC
GCGACGCTCACGGCAGAGCAGGAGACCAAGTACGAGGCGCTTCTGGGGCGGGCCAAGGCGCTGGACGAGATTCGG
TGCGACAAGGACAAGGAAAAGGCAAAGGCCAAGGGCGGGAAGAGCGAGGAGGAGAAGAGCAAGTCGGGTCCCGTG
ACGGAGGCGGAGCGGCGATGGCTCACGCGCGAATGCCTGCTTCGCTACCTGCGGGCGACGAAGTGGAACGTGGAC
GATGCGGCGAAACGGCTCGTATCGACGCTGGCGTGGAGACGCGAGTATGGCATCGACGAGTTTACGGCTGAGTAC
ATATCGCCTGAGCAGGAGACGGGCAAGCAGATGATTGTCGGCTTCGATCGCGTTGGGAGGCCGTGTCTGTATCTC
AACCCGGGGAGGCAGAATACTGACGCTTCGCCGCGGCAGCTGCATCACATGTTTTATATGATGGAGCGGGTCATG
GAGTTGATGCCGGCCGGAGTCGAGACGCTGAGCCTGCTCATCAACTTTAAGCCGACGAAGAAGAGGCAGAATACG
AGCGTGCCGGTCATGACGGCGAGGGAGGTGTTGCATATCCTGCAGAATCACTACCCCGAGAGGCTGGGAAAGGCG
CTGATTATCAACGTCCCTTGGGTCGTCAGCGGCTTCTTCAAGGTCATCACGCCCTTTATCGACCCCGTGACGCGC
GACAAGCTCAAGTTCAACGAGGATATGCGGCTGTACGTGCCGCCGGAGCAGCTCTGGAGCGCCGACTGGGGCGGC
GACATGGACTTTGAGTACGAGCACGCGACGTACTGGCCCGCGCTGCACGAGTTGTGCCGGGCGAGGAGGGAGCTG
AGGATCAAGAGGTGGGAGGCGGCTGGGGGAATCATCGGGGAGTCGGAGGTGTATCTCGCCGGCGGGACGGACGAG
AGCGTCGGGGGGGTTCGGTATCGGGGGGATGGGGATGGGGAGGTGGATGCCGTGGAGGAGAAGATGGCGGCGGTG
CAGGTGGGAGGCGGGGGGGTCGCCGAGGTGGCTGGCGAGGTGTAG
Transcript >Ophun1|5552
ATGGAGCCAACGGAGAGCCCGCCACGGAAGACGCCGCTGGAAGAGCCGTTGCCAGATTGCAAACCTGCGCCCAGC
GCGACGCTCACGGCAGAGCAGGAGACCAAGTACGAGGCGCTTCTGGGGCGGGCCAAGGCGCTGGACGAGATTCGG
TGCGACAAGGACAAGGAAAAGGCAAAGGCCAAGGGCGGGAAGAGCGAGGAGGAGAAGAGCAAGTCGGGTCCCGTG
ACGGAGGCGGAGCGGCGATGGCTCACGCGCGAATGCCTGCTTCGCTACCTGCGGGCGACGAAGTGGAACGTGGAC
GATGCGGCGAAACGGCTCGTATCGACGCTGGCGTGGAGACGCGAGTATGGCATCGACGAGTTTACGGCTGAGTAC
ATATCGCCTGAGCAGGAGACGGGCAAGCAGATGATTGTCGGCTTCGATCGCGTTGGGAGGCCGTGTCTGTATCTC
AACCCGGGGAGGCAGAATACTGACGCTTCGCCGCGGCAGCTGCATCACATGTTTTATATGATGGAGCGGGTCATG
GAGTTGATGCCGGCCGGAGTCGAGACGCTGAGCCTGCTCATCAACTTTAAGCCGACGAAGAAGAGGCAGAATACG
AGCGTGCCGGTCATGACGGCGAGGGAGGTGTTGCATATCCTGCAGAATCACTACCCCGAGAGGCTGGGAAAGGCG
CTGATTATCAACGTCCCTTGGGTCGTCAGCGGCTTCTTCAAGGTCATCACGCCCTTTATCGACCCCGTGACGCGC
GACAAGCTCAAGTTCAACGAGGATATGCGGCTGTACGTGCCGCCGGAGCAGCTCTGGAGCGCCGACTGGGGCGGC
GACATGGACTTTGAGTACGAGCACGCGACGTACTGGCCCGCGCTGCACGAGTTGTGCCGGGCGAGGAGGGAGCTG
AGGATCAAGAGGTGGGAGGCGGCTGGGGGAATCATCGGGGAGTCGGAGGTGTATCTCGCCGGCGGGACGGACGAG
AGCGTCGGGGGGGTTCGGTATCGGGGGGATGGGGATGGGGAGGTGGATGCCGTGGAGGAGAAGATGGCGGCGGTG
CAGGTGGGAGGCGGGGGGGTCGCCGAGGTGGCTGGCGAGGTGTAG
Gene >Ophun1|5552
ATGGAGCCAACGGAGAGCCCGCCACGGAAGACGCCGCTGGAAGAGCCGTTGCCAGATTGCAAACCTGCGCCCAGC
GCGACGCTCACGGCAGAGCAGGAGACCAAGTACGAGGCGCTTCTGGGGCGGGCCAAGGCGCTGGACGAGATTCGG
TGCGACAAGGACAAGGAAAAGGCAAAGGCCAAGGGCGGGAAGAGCGAGGAGGAGAAGAGCAAGTCGGGTCCCGTG
ACGGAGGCGGAGCGGCGATGGCTCACGCGCGAATGCCTGCTTCGCTACCTGCGGGCGACGAAGTGGAACGTGGAC
GATGCGGCGAAACGGCTCGTATCGACGCTGGCGTGGAGACGCGAGTATGGCATCGACGAGTTTACGGCTGAGTAC
ATATCGCCTGAGCAGGAGACGGGCAAGCAGATGATTGTCGGCTTCGATCGCGTTGGGAGGCCGTGTCTGTATCTC
AACCCGGGGAGGCAGAATACTGACGCTTCGCCGCGGCAGCTGCATCACATGTTTTATATGATGGAGCGGGTCATG
GAGTTGATGCCGGCCGGAGTCGAGACGCTGAGCCTGCTCATCAACTTTAAGCCGACGAAGAAGAGGCAGAATACG
AGCGTGCCGGTCATGACGGCGAGGGAGGTGTTGCATATCCTGCAGAATCACTACCCCGAGAGGCTGGGAAAGGCG
CTGATTATCAACGGTGAGTGCTGGACGAATCCTTCCATCTCTTTGCTGGGAGTGTGTTGCTGAGGCGGTGGAGCA
GTCCCTTGGGTCGTCAGCGGCTTCTTCAAGGTCATCACGCCCTTTATCGACCCCGTGACGCGCGACAAGCTCAAG
TTCAACGAGGATATGCGGCTGTACGTGCCGCCGGAGCAGCTCTGGAGCGCCGACTGGGGCGGCGACATGGACTTT
GAGTACGAGCACGCGACGTACTGGCCCGCGCTGCACGAGTTGTGCCGGGCGAGGAGGGAGCTGAGGATCAAGAGG
TGGGAGGCGGCTGGGGGAATCATCGGGGAGTCGGAGGTGTATCTCGCCGGCGGGACGGACGAGAGCGTCGGGGGG
GTTCGGTATCGGGGGGATGGGGATGGGGAGGTGGATGCCGTGGAGGAGAAGATGGCGGCGGTGCAGGTGGGAGGC
GGGGGGGTCGCCGAGGTGGCTGGCGAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail