Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|555
Gene name
LocationContig_117:35360..35694
Strand-
Gene length (bp)334
Transcript length (bp)210
Coding sequence length (bp)210
Protein length (aa) 70

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 2.5E+01 4 15
PF08238 Sel1 Sel1 repeat 5.5E-08 17 51

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5551
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|3946
Ophiocordyceps camponoti-floridani Ophcf2|00315
Ophiocordyceps camponoti-rufipedis Ophun1|555 (this protein)
Ophiocordyceps kimflemingae Ophio5|1329
Ophiocordyceps subramaniannii Hirsu2|7071

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|555
MVVLQYYETAANLGDTDAMNELARCYLEGLGCKKDKFAAARYYRRAEEAGSKTLGNSWIWKEKYDAKGS*
Coding >Ophun1|555
ATGGTTGTTCTGCAGTATTACGAGACGGCTGCCAACCTCGGCGATACAGATGCCATGAACGAGCTTGCCCGCTGC
TACCTCGAAGGCTTGGGCTGTAAGAAGGACAAGTTTGCGGCGGCGAGGTACTACCGACGGGCTGAAGAGGCGGGC
AGCAAGACGCTTGGGAACTCTTGGATATGGAAGGAAAAGTACGATGCAAAGGGATCGTGA
Transcript >Ophun1|555
ATGGTTGTTCTGCAGTATTACGAGACGGCTGCCAACCTCGGCGATACAGATGCCATGAACGAGCTTGCCCGCTGC
TACCTCGAAGGCTTGGGCTGTAAGAAGGACAAGTTTGCGGCGGCGAGGTACTACCGACGGGCTGAAGAGGCGGGC
AGCAAGACGCTTGGGAACTCTTGGATATGGAAGGAAAAGTACGATGCAAAGGGATCGTGA
Gene >Ophun1|555
ATGGTTGTTCTGCAGTATTACGAGACGGCTGCCAACCTCGGCGATACAGGTATGTTGTGCCTAGGTGTACGAATA
GTTAGGAATTGGTCTGAGAGACGGATGCAGATGCCATGAACGAGCTTGCCCGCTGCTACCTCGAAGGCTTGGGCT
GTAAGAAGGACAAGTTTGCGGCGGCGAGGTACTACCGACGGGCTGAAGAGGCGGGCAGCAAGACGCTTGGGAACT
CTTGGTATGTGTGTAGTTGCTATCCCCCTTGGCTTGCTCGTTGTTTGTCGTCTTTGCTGATGTTGCTCAAAGGAT
ATGGAAGGAAAAGTACGATGCAAAGGGATCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail