Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5542
Gene name
LocationContig_553:3151..9166
Strand+
Gene length (bp)6015
Transcript length (bp)5868
Coding sequence length (bp)5868
Protein length (aa) 1956

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16507 BLM10_mid Proteasome-substrate-size regulator, mid region 7.3E-194 385 912
PF11919 DUF3437 Domain of unknown function (DUF3437) 1.9E-29 1867 1955
PF16547 BLM10_N Proteasome-substrate-size regulator, N-terminal 4.3E-19 34 99

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NRP2|PSME4_XENLA Proteasome activator complex subunit 4 OS=Xenopus laevis GN=psme4 PE=2 SV=1 58 1949 4.0E-87
sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BLM10 PE=1 SV=2 967 1955 9.0E-67
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 58 1615 5.0E-63
sp|Q5SSW2|PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus GN=Psme4 PE=1 SV=1 57 1185 8.0E-62
sp|F1MKX4|PSME4_BOVIN Proteasome activator complex subunit 4 OS=Bos taurus GN=PSME4 PE=1 SV=1 31 1185 7.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NRP2|PSME4_XENLA Proteasome activator complex subunit 4 OS=Xenopus laevis GN=psme4 PE=2 SV=1 58 1949 4.0E-87
sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BLM10 PE=1 SV=2 967 1955 9.0E-67
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 58 1615 5.0E-63
sp|Q5SSW2|PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus GN=Psme4 PE=1 SV=1 57 1185 8.0E-62
sp|F1MKX4|PSME4_BOVIN Proteasome activator complex subunit 4 OS=Bos taurus GN=PSME4 PE=1 SV=1 31 1185 7.0E-60
sp|Q14997|PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens GN=PSME4 PE=1 SV=2 58 1185 3.0E-59
sp|F1QFR9|PSM4A_DANRE Proteasome activator complex subunit 4A OS=Danio rerio GN=psme4a PE=3 SV=2 58 1149 2.0E-56
sp|P43583|BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BLM10 PE=1 SV=2 102 914 9.0E-34
sp|Q14997|PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens GN=PSME4 PE=1 SV=2 1367 1949 2.0E-27
sp|Q5SSW2|PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus GN=Psme4 PE=1 SV=1 1367 1949 3.0E-25
sp|F1MKX4|PSME4_BOVIN Proteasome activator complex subunit 4 OS=Bos taurus GN=PSME4 PE=1 SV=1 1367 1949 3.0E-25
sp|F1QFR9|PSM4A_DANRE Proteasome activator complex subunit 4A OS=Danio rerio GN=psme4a PE=3 SV=2 1368 1949 1.0E-24
sp|F4JC97|PSME4_ARATH Proteasome activator subunit 4 OS=Arabidopsis thaliana GN=PA200 PE=2 SV=2 99 878 4.0E-20
sp|F1R2X6|PSM4B_DANRE Proteasome activator complex subunit 4B OS=Danio rerio GN=psme4b PE=3 SV=2 1761 1949 3.0E-17
sp|F4JC97|PSME4_ARATH Proteasome activator subunit 4 OS=Arabidopsis thaliana GN=PA200 PE=2 SV=2 1762 1955 1.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1633
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7072
Ophiocordyceps australis map64 (Brazil) OphauB2|2633
Ophiocordyceps camponoti-floridani Ophcf2|01357
Ophiocordyceps camponoti-rufipedis Ophun1|5542 (this protein)
Ophiocordyceps kimflemingae Ophio5|7756
Ophiocordyceps subramaniannii Hirsu2|1308

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5542
MDENIDISHEASHATHVPSMTSHLVSSFAVFEPVSRATSPGIPYPKTDEDDKKRYRPRTFAYFQQLPFEVEEESE
RDVALNGILKQLYIALRAQDYSPGALHWTRELQAWLNLKFEMTRELRARLAKLFYSLSLAPGLDANAADRFLRMV
ITLTRKNHYLKPVDDLLLDWRPLWKEVKAWVLPSEGPTHQSTRRRAAKQLLKLCTHAHTYFDPSQRPAMIEKLLP
YFGVNELPNAFIVIGTLNALLPSHPAPASEPLAQPQHFLPTLFHLWSIVNRSKVVDIFFMDLFSRLTRDHIHCDH
IPFGQFGIFTRDQSDLIFTAMLRLTQIPVGQANSPYTSIDYLSGAGLYLEKDKKKYPVAYMMARLITSSLSPSCL
EHPDSIMSSLEGLIESIDTFFHPSNQGSWSNLLGQFVLYLTDGFVSRWNREQSAELDIPNGRKISPKLKKRFVLS
LREVTFMGLFSKSSRISHCYYNALQGLAYLEPDLVLPGALQRFYPSLQGLVEVHRTTSSLNGLQMIANTMCKLKG
YRCHVTALLALALPGIDANDLNKTQYTLNFIQSVAYSVPFVSLTTEDSHIHDTTLAMQWVQAEMDRMERDGQNVQ
IDYATELSDEDETRILRSSTAGLSEFVLTLLGKIFTLLENLPDANQVRGGTPEDNVINALPSALSPLFASLSPDI
FDMALDKIATFVSSHVVHQARDAMAWILNALCKVNTAKTLKVFIPMLVVNIRSEIDYNNAASDRTTGTDYLPRDR
ALVWHISMLAMCVVHVGGEVLKYKEELLGIAEYMQDKCRGLPTILVSNYIHHLLLNLTHTYPIDHALYEPDVLKR
GLDVGDWGRTTAPADLTIRWHQPSPAEVEFAVELFASQVTSATRQLQLLMSDNPPVSREGKNKAWSDEVSRLMQQ
LRLAISGMAIMFDPKRASDDGGSDEGGGNADGDEEMMEEDEMLAGDADEEEEELRPQFRYRAGYPLKPKDPVYRR
IHELRDEIGHLLTKTHSFLNEKQEDDVNCFTALCSAYRTWITDVGIERSAHPLERHLRLYRADVAAFKIKGLRKV
YPRPLLIKRAEAYHILRVKHNASARHKSELDKRLLRDLAHSCLSLYADVRRVAQSAQDSSLKSLIGGRPIVLPVI
LDGFRAAIEANQHDRIKGGMYTLLYTSLLRTVLKDWRFAPEAMRLYIETAGIDKPSIQTLGSTALYSMFEFGKPL
DRAILLDDGVIDSIKPPRGDESAAIDKRHQMVVQRRKKVEDAKSALGLELTRRAKGAHWKIATRCAIFAANLCLR
FEDIAPTEFVDLVARGVNDPHPSLRSFFLNSLSALFGVIDMRAVYDHDYNNYLLEKEINDTNKLEIAVPKGDAQF
TRRFLDAFRDPEGAEYMVDSDHPGWLAWGKSFMAFRSRPVAFMAYDEVETAVRDQLGRVLTREWLSQCFDYLKQE
PRDQCTDRFRMQHVYLLMHVFDLMHYGNTAVTFDDVKELTSGIYGDGSDKHQHRATSEILGALLTGSSDDPPEIR
NRVWGFAAPMVLGVFRDDLTPENLQYWLACLHLVLDGKDPRRSHEIVDGLKSFRLDMSSNAAFKESSKLQLVEFI
VADGGWHFRDTGPIQEHLVAHIDHPYKAVREAIGRLLSALEKSQYYEAFESVPKLLEENKASSSVGIRPYQPSPE
LTATMTGIFDRLERWRHERTPGQQTPSSYTSGSKTVLMWLDCTLSSHECVELVPFFATPFVEQLLHMMDVKEDPE
LMKLAYHVYRHLPNIPFRKGEDAGLCESLIRVGRTAASWHQRLRALVNMQSLYFRRIFMLGAPQRDGLFTAVSDM
LSDAQLEVRSCASTTLAGMIRCSPGQIRGPMVARLKRRFEEELQQNPMPRRSQGGTETPVDVQRQVTRRHAAVLG
LGALIEAFPYATPPPEWMPEVLAMLARKASGDAGVVGKATKGILSEFKKTRQDSWSVDQKYFTSEQLEDLEGVLW
KSYFA*
Coding >Ophun1|5542
ATGGACGAAAACATCGACATATCTCACGAGGCTTCCCACGCCACCCACGTCCCGTCCATGACGTCGCACCTCGTC
AGCAGCTTCGCCGTCTTCGAGCCCGTCTCCCGCGCTACCTCGCCCGGCATTCCCTATCCCAAGACGGACGAAGAC
GACAAGAAGCGATATCGCCCTCGCACATTTGCCTATTTCCAGCAGTTGCCTTTTGAGGTTGAGGAGGAGTCGGAG
CGCGACGTCGCCCTCAATGGCATCCTCAAGCAGCTCTACATCGCCCTGCGCGCCCAGGATTATTCGCCGGGCGCT
CTGCACTGGACTAGGGAGCTCCAGGCCTGGCTGAACCTCAAGTTCGAGATGACGAGGGAGCTGAGGGCGCGGCTG
GCCAAGCTGTTCTACTCGCTCTCTCTGGCTCCCGGGCTTGATGCCAACGCGGCGGACCGCTTTCTGCGCATGGTC
ATCACGCTCACCAGGAAAAATCATTACCTCAAGCCTGTCGACGATCTTCTCCTCGACTGGAGACCCTTGTGGAAA
GAGGTCAAGGCCTGGGTTTTGCCCTCCGAGGGTCCTACTCATCAGAGCACCCGCAGACGTGCGGCGAAGCAGCTC
CTCAAGCTCTGCACGCATGCGCACACCTACTTCGACCCCAGCCAGCGTCCGGCCATGATAGAGAAGCTGCTTCCT
TACTTTGGCGTCAACGAGCTCCCCAACGCCTTCATCGTCATCGGCACCCTCAACGCCCTGCTGCCCAGCCATCCC
GCTCCGGCCAGCGAGCCCCTGGCCCAGCCGCAGCACTTCCTGCCGACCCTCTTCCATCTGTGGTCCATCGTGAAT
CGCTCCAAGGTCGTCGACATCTTCTTCATGGACCTCTTCTCCCGCCTGACCCGCGACCACATTCACTGCGACCAC
ATTCCGTTTGGCCAGTTCGGCATCTTCACCCGGGACCAGTCGGACCTCATCTTCACCGCCATGCTCCGCCTGACG
CAGATTCCCGTCGGTCAGGCCAACTCGCCATACACCTCCATCGATTACCTCTCGGGGGCCGGTCTTTACCTCGAA
AAGGATAAGAAAAAGTACCCCGTCGCGTACATGATGGCCCGCCTCATCACCAGCAGTCTGTCCCCGAGCTGTCTG
GAGCATCCAGACTCGATCATGTCGAGCCTCGAGGGCCTCATCGAGTCCATCGATACATTTTTTCATCCGTCGAAT
CAAGGATCTTGGTCTAATCTTCTGGGGCAGTTCGTCCTCTACCTCACCGACGGCTTCGTTTCACGGTGGAACCGC
GAGCAGAGCGCGGAACTCGACATCCCGAACGGCCGCAAGATCAGCCCCAAGCTGAAGAAGCGCTTCGTCCTCTCC
CTCAGGGAGGTGACCTTTATGGGCCTCTTCTCCAAGAGCAGTCGCATTTCGCACTGCTACTACAACGCCCTCCAG
GGCCTGGCCTACCTGGAGCCGGACCTCGTGCTGCCCGGAGCGCTGCAGCGGTTCTACCCCAGTCTGCAAGGCCTG
GTCGAGGTCCACCGCACGACTTCGAGCTTGAACGGCCTGCAGATGATCGCCAACACCATGTGCAAGCTCAAGGGC
TATCGCTGCCACGTGACGGCCCTGCTGGCCCTCGCGCTGCCGGGCATCGACGCCAACGATCTCAACAAGACGCAG
TACACGCTCAACTTCATCCAGAGCGTCGCTTACAGCGTGCCCTTCGTCTCCTTGACGACCGAGGACAGCCACATC
CACGACACGACGCTGGCCATGCAGTGGGTGCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAG
ATCGATTACGCTACCGAGCTCAGCGACGAGGACGAGACGCGAATCCTGAGGTCTTCGACGGCCGGACTGAGCGAG
TTTGTCCTGACGCTCCTCGGCAAGATCTTCACCCTACTGGAGAATCTGCCGGATGCTAACCAGGTCCGGGGAGGT
ACGCCGGAGGACAACGTTATCAACGCATTGCCGTCGGCGCTGTCGCCTCTCTTCGCCTCGCTGTCGCCGGACATC
TTCGACATGGCGCTCGACAAGATTGCCACGTTCGTCTCGAGCCACGTGGTGCACCAGGCTCGCGACGCCATGGCC
TGGATTCTCAACGCCCTGTGCAAGGTGAACACGGCCAAGACGCTCAAGGTCTTTATCCCGATGCTCGTCGTCAAC
ATCCGCAGCGAGATAGACTACAACAACGCCGCCTCGGACCGGACCACGGGCACCGACTACCTCCCCCGAGACCGG
GCTCTGGTATGGCACATCAGCATGCTCGCCATGTGCGTCGTCCACGTCGGCGGCGAGGTGCTCAAGTACAAGGAG
GAGCTGCTTGGCATAGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATACTCGTGTCCAACTACATC
CACCACCTGCTCCTGAACCTGACGCACACGTATCCCATCGACCACGCGCTGTACGAGCCGGACGTGCTCAAGAGG
GGGCTCGATGTCGGAGACTGGGGCAGGACGACGGCGCCGGCAGATCTCACCATCCGCTGGCACCAGCCCTCGCCG
GCCGAGGTCGAGTTTGCCGTGGAGCTTTTCGCGTCCCAGGTGACGTCTGCCACGCGGCAGCTGCAGCTCCTCATG
AGCGACAACCCGCCCGTGAGCAGGGAGGGCAAGAACAAGGCCTGGTCTGATGAGGTGTCGAGACTCATGCAGCAA
TTGCGCCTCGCCATATCTGGCATGGCCATCATGTTTGATCCGAAGCGCGCGTCCGACGACGGCGGCAGCGATGAG
GGTGGAGGCAACGCCGACGGTGACGAAGAGATGATGGAGGAAGACGAGATGCTGGCCGGAGACGCCGACGAGGAG
GAGGAGGAGCTCCGGCCGCAGTTCCGATACCGGGCGGGATACCCCCTGAAGCCCAAGGACCCGGTCTATCGGCGG
ATACACGAGCTGCGGGACGAGATCGGCCACCTCCTGACCAAGACGCACTCGTTCCTCAACGAGAAGCAGGAAGAC
GACGTCAACTGCTTCACCGCCCTGTGCTCGGCGTACCGCACGTGGATCACGGACGTGGGCATAGAGCGATCGGCC
CACCCGCTCGAGAGGCACCTGAGGCTGTACAGGGCCGACGTGGCCGCCTTCAAGATCAAGGGGCTGAGGAAGGTC
TACCCCCGGCCGCTGCTGATCAAGCGGGCCGAGGCGTACCACATCCTGCGAGTTAAGCACAACGCGTCGGCCAGG
CACAAGAGCGAGCTCGACAAGCGGCTCCTGCGCGACCTGGCGCACTCGTGCTTGAGCCTGTATGCCGACGTGCGG
AGGGTGGCGCAGAGCGCGCAGGACTCTTCGCTCAAGTCCCTCATCGGCGGCCGGCCCATCGTGCTCCCCGTCATA
CTCGACGGCTTCCGCGCCGCCATCGAGGCCAACCAGCACGACCGGATCAAGGGCGGCATGTACACGCTGCTCTAC
ACGTCCCTGCTGCGGACCGTTCTCAAGGACTGGCGTTTCGCGCCCGAGGCCATGCGGCTTTACATCGAGACAGCG
GGTATCGACAAGCCGTCCATCCAGACGCTGGGCTCGACGGCGCTCTACTCCATGTTCGAGTTCGGCAAGCCTCTC
GACCGGGCCATCCTGTTGGACGACGGGGTGATCGACTCGATCAAGCCGCCGCGGGGCGACGAGTCGGCGGCCATC
GACAAGAGGCATCAGATGGTGGTGCAGAGGCGCAAGAAGGTCGAGGACGCCAAGTCGGCGCTCGGGCTGGAGCTG
ACGCGGAGGGCAAAGGGAGCACACTGGAAGATTGCGACTAGATGCGCCATCTTTGCCGCCAACTTGTGCCTCCGC
TTCGAAGACATCGCACCGACCGAGTTCGTGGACCTGGTGGCCCGGGGCGTCAACGACCCGCATCCCAGTCTGAGG
AGCTTCTTCCTGAACTCGCTGTCGGCTCTCTTCGGCGTCATCGATATGCGGGCCGTCTACGACCACGACTATAAC
AACTATCTCCTGGAGAAGGAGATCAACGACACCAACAAGCTCGAGATAGCCGTGCCCAAGGGCGACGCCCAGTTC
ACGCGCCGCTTCCTCGACGCCTTCCGGGACCCCGAGGGCGCCGAGTATATGGTCGACTCTGACCATCCGGGGTGG
CTCGCATGGGGAAAGAGCTTCATGGCGTTCCGATCTCGTCCCGTTGCCTTTATGGCGTACGACGAGGTCGAGACG
GCGGTGCGGGACCAGCTTGGCAGGGTCTTGACGAGGGAGTGGTTGTCGCAGTGCTTCGATTACCTCAAGCAGGAG
CCGCGCGATCAGTGTACGGACAGGTTCCGGATGCAGCATGTCTACCTGCTCATGCACGTCTTCGACCTGATGCAC
TACGGCAATACGGCGGTGACGTTTGACGACGTCAAGGAGCTGACGAGCGGCATCTACGGCGACGGGAGCGACAAG
CACCAACACCGGGCGACGTCGGAGATCTTGGGGGCGCTGCTGACGGGATCGAGCGACGACCCGCCCGAGATCCGG
AACCGCGTATGGGGGTTTGCGGCGCCCATGGTGCTGGGCGTCTTCAGGGACGACCTGACGCCGGAGAATCTGCAG
TACTGGCTGGCGTGTCTGCACCTTGTGCTCGACGGCAAGGACCCGCGCCGGTCGCACGAGATCGTCGACGGGCTC
AAGTCGTTCCGGCTCGACATGTCGTCCAACGCGGCCTTCAAGGAGTCGTCCAAGCTGCAGCTCGTCGAGTTCATA
GTGGCCGACGGCGGGTGGCACTTTCGCGACACGGGGCCGATCCAGGAGCACTTGGTGGCGCACATCGACCACCCG
TACAAGGCGGTGCGCGAGGCCATTGGGCGGCTGCTGTCGGCGCTGGAGAAGTCGCAGTACTACGAGGCGTTTGAG
AGCGTGCCGAAGCTGCTGGAGGAGAACAAGGCGTCGTCGTCGGTCGGCATCCGGCCGTACCAGCCGTCGCCGGAG
CTGACGGCGACCATGACGGGCATCTTTGATCGGCTGGAGCGGTGGCGGCACGAGCGGACGCCGGGGCAGCAGACG
CCGTCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTGGACTGCACGCTGTCGTCGCACGAGTGCGTG
GAGCTGGTGCCCTTCTTCGCGACGCCCTTTGTCGAGCAGCTGCTGCACATGATGGACGTCAAGGAGGACCCGGAG
CTTATGAAGCTGGCCTACCACGTGTACCGACACCTGCCCAACATACCGTTCCGCAAGGGCGAGGACGCGGGCCTC
TGCGAGAGCCTCATCAGGGTCGGGCGGACGGCGGCGAGCTGGCACCAGAGGCTGCGGGCGCTGGTCAACATGCAG
AGCCTCTACTTCCGGCGCATCTTCATGCTCGGGGCGCCGCAGCGCGACGGGCTCTTCACGGCCGTGTCGGACATG
CTGAGCGACGCTCAGCTCGAGGTGCGGTCGTGCGCGTCGACGACGCTGGCGGGCATGATCCGGTGCTCTCCGGGG
CAGATCCGGGGCCCCATGGTGGCGCGGCTCAAGCGGCGCTTCGAGGAGGAGCTGCAGCAGAACCCGATGCCCCGG
CGGTCGCAGGGCGGGACGGAGACGCCGGTGGATGTGCAGCGGCAGGTGACGAGGCGACACGCAGCGGTGCTGGGG
CTGGGGGCGCTGATCGAGGCGTTTCCGTACGCGACGCCGCCGCCCGAGTGGATGCCCGAGGTGCTGGCGATGCTG
GCGCGCAAGGCTTCGGGAGACGCGGGCGTGGTGGGCAAGGCGACCAAGGGGATATTGAGCGAGTTCAAGAAGACG
AGGCAGGACAGCTGGAGCGTGGATCAGAAGTACTTTACGTCGGAACAGCTGGAGGATTTGGAAGGAGTGCTGTGG
AAGAGCTACTTTGCCTGA
Transcript >Ophun1|5542
ATGGACGAAAACATCGACATATCTCACGAGGCTTCCCACGCCACCCACGTCCCGTCCATGACGTCGCACCTCGTC
AGCAGCTTCGCCGTCTTCGAGCCCGTCTCCCGCGCTACCTCGCCCGGCATTCCCTATCCCAAGACGGACGAAGAC
GACAAGAAGCGATATCGCCCTCGCACATTTGCCTATTTCCAGCAGTTGCCTTTTGAGGTTGAGGAGGAGTCGGAG
CGCGACGTCGCCCTCAATGGCATCCTCAAGCAGCTCTACATCGCCCTGCGCGCCCAGGATTATTCGCCGGGCGCT
CTGCACTGGACTAGGGAGCTCCAGGCCTGGCTGAACCTCAAGTTCGAGATGACGAGGGAGCTGAGGGCGCGGCTG
GCCAAGCTGTTCTACTCGCTCTCTCTGGCTCCCGGGCTTGATGCCAACGCGGCGGACCGCTTTCTGCGCATGGTC
ATCACGCTCACCAGGAAAAATCATTACCTCAAGCCTGTCGACGATCTTCTCCTCGACTGGAGACCCTTGTGGAAA
GAGGTCAAGGCCTGGGTTTTGCCCTCCGAGGGTCCTACTCATCAGAGCACCCGCAGACGTGCGGCGAAGCAGCTC
CTCAAGCTCTGCACGCATGCGCACACCTACTTCGACCCCAGCCAGCGTCCGGCCATGATAGAGAAGCTGCTTCCT
TACTTTGGCGTCAACGAGCTCCCCAACGCCTTCATCGTCATCGGCACCCTCAACGCCCTGCTGCCCAGCCATCCC
GCTCCGGCCAGCGAGCCCCTGGCCCAGCCGCAGCACTTCCTGCCGACCCTCTTCCATCTGTGGTCCATCGTGAAT
CGCTCCAAGGTCGTCGACATCTTCTTCATGGACCTCTTCTCCCGCCTGACCCGCGACCACATTCACTGCGACCAC
ATTCCGTTTGGCCAGTTCGGCATCTTCACCCGGGACCAGTCGGACCTCATCTTCACCGCCATGCTCCGCCTGACG
CAGATTCCCGTCGGTCAGGCCAACTCGCCATACACCTCCATCGATTACCTCTCGGGGGCCGGTCTTTACCTCGAA
AAGGATAAGAAAAAGTACCCCGTCGCGTACATGATGGCCCGCCTCATCACCAGCAGTCTGTCCCCGAGCTGTCTG
GAGCATCCAGACTCGATCATGTCGAGCCTCGAGGGCCTCATCGAGTCCATCGATACATTTTTTCATCCGTCGAAT
CAAGGATCTTGGTCTAATCTTCTGGGGCAGTTCGTCCTCTACCTCACCGACGGCTTCGTTTCACGGTGGAACCGC
GAGCAGAGCGCGGAACTCGACATCCCGAACGGCCGCAAGATCAGCCCCAAGCTGAAGAAGCGCTTCGTCCTCTCC
CTCAGGGAGGTGACCTTTATGGGCCTCTTCTCCAAGAGCAGTCGCATTTCGCACTGCTACTACAACGCCCTCCAG
GGCCTGGCCTACCTGGAGCCGGACCTCGTGCTGCCCGGAGCGCTGCAGCGGTTCTACCCCAGTCTGCAAGGCCTG
GTCGAGGTCCACCGCACGACTTCGAGCTTGAACGGCCTGCAGATGATCGCCAACACCATGTGCAAGCTCAAGGGC
TATCGCTGCCACGTGACGGCCCTGCTGGCCCTCGCGCTGCCGGGCATCGACGCCAACGATCTCAACAAGACGCAG
TACACGCTCAACTTCATCCAGAGCGTCGCTTACAGCGTGCCCTTCGTCTCCTTGACGACCGAGGACAGCCACATC
CACGACACGACGCTGGCCATGCAGTGGGTGCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAG
ATCGATTACGCTACCGAGCTCAGCGACGAGGACGAGACGCGAATCCTGAGGTCTTCGACGGCCGGACTGAGCGAG
TTTGTCCTGACGCTCCTCGGCAAGATCTTCACCCTACTGGAGAATCTGCCGGATGCTAACCAGGTCCGGGGAGGT
ACGCCGGAGGACAACGTTATCAACGCATTGCCGTCGGCGCTGTCGCCTCTCTTCGCCTCGCTGTCGCCGGACATC
TTCGACATGGCGCTCGACAAGATTGCCACGTTCGTCTCGAGCCACGTGGTGCACCAGGCTCGCGACGCCATGGCC
TGGATTCTCAACGCCCTGTGCAAGGTGAACACGGCCAAGACGCTCAAGGTCTTTATCCCGATGCTCGTCGTCAAC
ATCCGCAGCGAGATAGACTACAACAACGCCGCCTCGGACCGGACCACGGGCACCGACTACCTCCCCCGAGACCGG
GCTCTGGTATGGCACATCAGCATGCTCGCCATGTGCGTCGTCCACGTCGGCGGCGAGGTGCTCAAGTACAAGGAG
GAGCTGCTTGGCATAGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATACTCGTGTCCAACTACATC
CACCACCTGCTCCTGAACCTGACGCACACGTATCCCATCGACCACGCGCTGTACGAGCCGGACGTGCTCAAGAGG
GGGCTCGATGTCGGAGACTGGGGCAGGACGACGGCGCCGGCAGATCTCACCATCCGCTGGCACCAGCCCTCGCCG
GCCGAGGTCGAGTTTGCCGTGGAGCTTTTCGCGTCCCAGGTGACGTCTGCCACGCGGCAGCTGCAGCTCCTCATG
AGCGACAACCCGCCCGTGAGCAGGGAGGGCAAGAACAAGGCCTGGTCTGATGAGGTGTCGAGACTCATGCAGCAA
TTGCGCCTCGCCATATCTGGCATGGCCATCATGTTTGATCCGAAGCGCGCGTCCGACGACGGCGGCAGCGATGAG
GGTGGAGGCAACGCCGACGGTGACGAAGAGATGATGGAGGAAGACGAGATGCTGGCCGGAGACGCCGACGAGGAG
GAGGAGGAGCTCCGGCCGCAGTTCCGATACCGGGCGGGATACCCCCTGAAGCCCAAGGACCCGGTCTATCGGCGG
ATACACGAGCTGCGGGACGAGATCGGCCACCTCCTGACCAAGACGCACTCGTTCCTCAACGAGAAGCAGGAAGAC
GACGTCAACTGCTTCACCGCCCTGTGCTCGGCGTACCGCACGTGGATCACGGACGTGGGCATAGAGCGATCGGCC
CACCCGCTCGAGAGGCACCTGAGGCTGTACAGGGCCGACGTGGCCGCCTTCAAGATCAAGGGGCTGAGGAAGGTC
TACCCCCGGCCGCTGCTGATCAAGCGGGCCGAGGCGTACCACATCCTGCGAGTTAAGCACAACGCGTCGGCCAGG
CACAAGAGCGAGCTCGACAAGCGGCTCCTGCGCGACCTGGCGCACTCGTGCTTGAGCCTGTATGCCGACGTGCGG
AGGGTGGCGCAGAGCGCGCAGGACTCTTCGCTCAAGTCCCTCATCGGCGGCCGGCCCATCGTGCTCCCCGTCATA
CTCGACGGCTTCCGCGCCGCCATCGAGGCCAACCAGCACGACCGGATCAAGGGCGGCATGTACACGCTGCTCTAC
ACGTCCCTGCTGCGGACCGTTCTCAAGGACTGGCGTTTCGCGCCCGAGGCCATGCGGCTTTACATCGAGACAGCG
GGTATCGACAAGCCGTCCATCCAGACGCTGGGCTCGACGGCGCTCTACTCCATGTTCGAGTTCGGCAAGCCTCTC
GACCGGGCCATCCTGTTGGACGACGGGGTGATCGACTCGATCAAGCCGCCGCGGGGCGACGAGTCGGCGGCCATC
GACAAGAGGCATCAGATGGTGGTGCAGAGGCGCAAGAAGGTCGAGGACGCCAAGTCGGCGCTCGGGCTGGAGCTG
ACGCGGAGGGCAAAGGGAGCACACTGGAAGATTGCGACTAGATGCGCCATCTTTGCCGCCAACTTGTGCCTCCGC
TTCGAAGACATCGCACCGACCGAGTTCGTGGACCTGGTGGCCCGGGGCGTCAACGACCCGCATCCCAGTCTGAGG
AGCTTCTTCCTGAACTCGCTGTCGGCTCTCTTCGGCGTCATCGATATGCGGGCCGTCTACGACCACGACTATAAC
AACTATCTCCTGGAGAAGGAGATCAACGACACCAACAAGCTCGAGATAGCCGTGCCCAAGGGCGACGCCCAGTTC
ACGCGCCGCTTCCTCGACGCCTTCCGGGACCCCGAGGGCGCCGAGTATATGGTCGACTCTGACCATCCGGGGTGG
CTCGCATGGGGAAAGAGCTTCATGGCGTTCCGATCTCGTCCCGTTGCCTTTATGGCGTACGACGAGGTCGAGACG
GCGGTGCGGGACCAGCTTGGCAGGGTCTTGACGAGGGAGTGGTTGTCGCAGTGCTTCGATTACCTCAAGCAGGAG
CCGCGCGATCAGTGTACGGACAGGTTCCGGATGCAGCATGTCTACCTGCTCATGCACGTCTTCGACCTGATGCAC
TACGGCAATACGGCGGTGACGTTTGACGACGTCAAGGAGCTGACGAGCGGCATCTACGGCGACGGGAGCGACAAG
CACCAACACCGGGCGACGTCGGAGATCTTGGGGGCGCTGCTGACGGGATCGAGCGACGACCCGCCCGAGATCCGG
AACCGCGTATGGGGGTTTGCGGCGCCCATGGTGCTGGGCGTCTTCAGGGACGACCTGACGCCGGAGAATCTGCAG
TACTGGCTGGCGTGTCTGCACCTTGTGCTCGACGGCAAGGACCCGCGCCGGTCGCACGAGATCGTCGACGGGCTC
AAGTCGTTCCGGCTCGACATGTCGTCCAACGCGGCCTTCAAGGAGTCGTCCAAGCTGCAGCTCGTCGAGTTCATA
GTGGCCGACGGCGGGTGGCACTTTCGCGACACGGGGCCGATCCAGGAGCACTTGGTGGCGCACATCGACCACCCG
TACAAGGCGGTGCGCGAGGCCATTGGGCGGCTGCTGTCGGCGCTGGAGAAGTCGCAGTACTACGAGGCGTTTGAG
AGCGTGCCGAAGCTGCTGGAGGAGAACAAGGCGTCGTCGTCGGTCGGCATCCGGCCGTACCAGCCGTCGCCGGAG
CTGACGGCGACCATGACGGGCATCTTTGATCGGCTGGAGCGGTGGCGGCACGAGCGGACGCCGGGGCAGCAGACG
CCGTCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTGGACTGCACGCTGTCGTCGCACGAGTGCGTG
GAGCTGGTGCCCTTCTTCGCGACGCCCTTTGTCGAGCAGCTGCTGCACATGATGGACGTCAAGGAGGACCCGGAG
CTTATGAAGCTGGCCTACCACGTGTACCGACACCTGCCCAACATACCGTTCCGCAAGGGCGAGGACGCGGGCCTC
TGCGAGAGCCTCATCAGGGTCGGGCGGACGGCGGCGAGCTGGCACCAGAGGCTGCGGGCGCTGGTCAACATGCAG
AGCCTCTACTTCCGGCGCATCTTCATGCTCGGGGCGCCGCAGCGCGACGGGCTCTTCACGGCCGTGTCGGACATG
CTGAGCGACGCTCAGCTCGAGGTGCGGTCGTGCGCGTCGACGACGCTGGCGGGCATGATCCGGTGCTCTCCGGGG
CAGATCCGGGGCCCCATGGTGGCGCGGCTCAAGCGGCGCTTCGAGGAGGAGCTGCAGCAGAACCCGATGCCCCGG
CGGTCGCAGGGCGGGACGGAGACGCCGGTGGATGTGCAGCGGCAGGTGACGAGGCGACACGCAGCGGTGCTGGGG
CTGGGGGCGCTGATCGAGGCGTTTCCGTACGCGACGCCGCCGCCCGAGTGGATGCCCGAGGTGCTGGCGATGCTG
GCGCGCAAGGCTTCGGGAGACGCGGGCGTGGTGGGCAAGGCGACCAAGGGGATATTGAGCGAGTTCAAGAAGACG
AGGCAGGACAGCTGGAGCGTGGATCAGAAGTACTTTACGTCGGAACAGCTGGAGGATTTGGAAGGAGTGCTGTGG
AAGAGCTACTTTGCCTGA
Gene >Ophun1|5542
ATGGACGAAAACATCGACATATCTCACGAGGCTTCCCACGCCACCCACGTCCCGTCCATGACGTCGCACCTCGTC
AGCAGCTTCGCCGTCTTCGAGCCCGTCTCCCGCGCTACCTCGCCCGGCATTCCCTATCCCAAGACGGACGAAGAC
GACAAGAAGCGATATCGCCCTCGCACATTTGCCTATTTCCAGCAGTTGCCTTTTGAGGTTGAGGAGGAGTCGGAG
CGCGACGTCGCCCTCAATGGCATCCTCAAGCAGCTCTACATCGCCCTGCGCGCCCAGGATTATTCGCCGGGCGCT
CTGCACTGGACTAGGGAGCTCCAGGCCTGGCTGAACCTCAAGTTCGAGATGACGAGGGAGCTGAGGGCGCGGCTG
GCCAAGCTGTTCTACTCGCTCTCTCTGGCTCCCGGGCTTGATGCCAACGCGGCGGACCGCTTTCTGCGCATGGTC
ATCACGCTCACCAGGTACGAGACAGAATCCTCTTCCCCCTCACCCGTTTCCAGACGCTGCTGTCTAGAGCTGGCT
AACGCTTTTCTTGCGATAGGAAAAATCATTACCTCAAGCCTGTCGACGATCTTCTCCTCGACTGGAGACCCTTGT
GGAAAGAGGTCAAGGCCTGGGTTTTGCCCTCCGAGGGTCCTACTCATCAGAGCACCCGCAGACGTGCGGCGAAGC
AGCTCCTCAAGCTCTGCACGCATGCGCACACCTACTTCGACCCCAGCCAGCGTCCGGCCATGATAGAGAAGCTGC
TTCCTTACTTTGGCGTCAACGAGCTCCCCAACGCCTTCATCGTCATCGGCACCCTCAACGCCCTGCTGCCCAGCC
ATCCCGCTCCGGCCAGCGAGCCCCTGGCCCAGCCGCAGCACTTCCTGCCGACCCTCTTCCATCTGTGGTCCATCG
TGAATCGCTCCAAGGTCGTCGACATCTTCTTCATGGACCTCTTCTCCCGCCTGACCCGCGACCACATTCACTGCG
ACCACATTCCGTTTGGCCAGTTCGGCATCTTCACCCGGGACCAGTCGGACCTCATCTTCACCGCCATGCTCCGCC
TGACGCAGATTCCCGTCGGTCAGGCCAACTCGCCATACACCTCCATCGATTACCTCTCGGGGGCCGGTCTTTACC
TCGAAAAGGATAAGAAAAAGTACCCCGTCGCGTACATGATGGCCCGCCTCATCACCAGCAGTCTGTCCCCGAGCT
GTCTGGAGCATCCAGACTCGATCATGTCGAGCCTCGAGGGCCTCATCGAGTCCATCGATACATTTTTTCATCCGT
CGAATCAAGGATCTTGGTCTAATCTTCTGGGGCAGTTCGTCCTCTACCTCACCGACGGCTTCGTTTCACGGTGGA
ACCGCGAGCAGAGCGCGGAACTCGACATCCCGAACGGCCGCAAGATCAGCCCCAAGCTGAAGAAGCGCTTCGTCC
TCTCCCTCAGGGAGGTGACCTTTATGGGCCTCTTCTCCAAGAGCAGTCGCATTTCGCACTGCTACTACAACGCCC
TCCAGGGCCTGGCCTACCTGGAGCCGGACCTCGTGCTGCCCGGAGCGCTGCAGCGGTTCTACCCCAGTCTGCAAG
GCCTGGTCGAGGTCCACCGCACGACTTCGAGCTTGAACGGCCTGCAGATGATCGCCAACACCATGTGCAAGCTCA
AGGGCTATCGCTGCCACGTGACGGCCCTGCTGGCCCTCGCGCTGCCGGGCATCGACGCCAACGATCTCAACAAGA
CGCAGTACACGCTCAACTTCATCCAGAGCGTCGCTTACAGCGTGCCCTTCGTCTCCTTGACGACCGAGGACAGCC
ACATCCACGACACGACGCTGGCCATGCAGTGGGTGCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACG
TCCAGATCGATTACGCTACCGAGCTCAGCGACGAGGACGAGACGCGAATCCTGAGGTCTTCGACGGCCGGACTGA
GCGAGTTTGTCCTGACGCTCCTCGGCAAGATCTTCACCCTACTGGAGAATCTGCCGGATGCTAACCAGGTCCGGG
GAGGTACGCCGGAGGACAACGTTATCAACGCATTGCCGTCGGCGCTGTCGCCTCTCTTCGCCTCGCTGTCGCCGG
ACATCTTCGACATGGCGCTCGACAAGATTGCCACGTTCGTCTCGAGCCACGTGGTGCACCAGGCTCGCGACGCCA
TGGCCTGGATTCTCAACGCCCTGTGCAAGGTGAACACGGCCAAGACGCTCAAGGTCTTTATCCCGATGCTCGTCG
TCAACATCCGCAGCGAGATAGACTACAACAACGCCGCCTCGGACCGGACCACGGGCACCGACTACCTCCCCCGAG
ACCGGGCTCTGGTATGGCACATCAGCATGCTCGCCATGTGCGTCGTCCACGTCGGCGGCGAGGTGCTCAAGTACA
AGGAGGAGCTGCTTGGCATAGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATACTCGTGTCCAACT
ACATCCACCACCTGCTCCTGAACCTGACGCACACGTATCCCATCGACCACGCGCTGTACGAGCCGGACGTGCTCA
AGAGGGGGCTCGATGTCGGAGACTGGGGCAGGACGACGGCGCCGGCAGATCTCACCATCCGCTGGCACCAGCCCT
CGCCGGCCGAGGTCGAGTTTGCCGTGGAGCTTTTCGCGTCCCAGGTGACGTCTGCCACGCGGCAGCTGCAGCTCC
TCATGAGCGACAACCCGCCCGTGAGCAGGGAGGGCAAGAACAAGGCCTGGTCTGATGAGGTGTCGAGACTCATGC
AGCAATTGCGCCTCGCCATATCTGGCATGGCCATCATGTTTGATCCGAAGCGCGCGTCCGACGACGGCGGCAGCG
ATGAGGGTGGAGGCAACGCCGACGGTGACGAAGAGATGATGGAGGAAGACGAGATGCTGGCCGGAGACGCCGACG
AGGAGGAGGAGGAGCTCCGGCCGCAGTTCCGATACCGGGCGGGATACCCCCTGAAGCCCAAGGACCCGGTCTATC
GGCGGATACACGAGCTGCGGGACGAGATCGGCCACCTCCTGACCAAGACGCACTCGTTCCTCAACGAGAAGCAGG
AAGACGACGTCAACTGCTTCACCGCCCTGTGCTCGGCGTACCGCACGTGGATCACGGACGTGGGCATAGAGCGAT
CGGCCCACCCGCTCGAGAGGCACCTGAGGCTGTACAGGGCCGACGTGGCCGCCTTCAAGATCAAGGGGCTGAGGA
AGGTCTACCCCCGGCCGCTGCTGATCAAGCGGGCCGAGGCGTACCACATCCTGCGAGTTAAGCACAACGCGTCGG
CCAGGCACAAGAGCGAGCTCGACAAGCGGCTCCTGCGCGACCTGGCGCACTCGTGCTTGAGCCTGTATGCCGACG
TGCGGAGGGTGGCGCAGAGCGCGCAGGACTCTTCGCTCAAGTCCCTCATCGGCGGCCGGCCCATCGTGCTCCCCG
TCATACTCGACGGCTTCCGCGCCGCCATCGAGGCCAACCAGCACGACCGGATCAAGGGCGGCATGTACACGCTGC
TCTACACGTCCCTGCTGCGGACCGTTCTCAAGGACTGGCGTTTCGCGCCCGAGGCCATGCGGCTTTACATCGAGA
CAGCGGGTATCGACAAGCCGTCCATCCAGACGCTGGGCTCGACGGCGCTCTACTCCATGTTCGAGTTCGGCAAGC
CTCTCGACCGGGCCATCCTGTTGGACGACGGGGTGATCGACTCGATCAAGCCGCCGCGGGGCGACGAGTCGGCGG
CCATCGACAAGAGGCATCAGATGGTGGTGCAGAGGCGCAAGAAGGTCGAGGACGCCAAGTCGGCGCTCGGGCTGG
AGCTGACGCGGAGGGCAAAGGGAGCACACTGGAAGATTGCGACTAGATGCGCCATCTTTGCCGCCAACTTGTGCC
TCCGCTTCGAAGACATCGCACCGACCGAGTTCGTGGACCTGGTGGCCCGGGGCGTCAACGACCCGCATCCCAGTC
TGAGGAGCTTCTTCCTGAACTCGCTGTCGGCTCTCTTCGGCGTCATCGATATGCGGGCCGTCTACGACCACGACT
ATAACAACTATCTCCTGGAGAAGGAGATCAACGACACCAACAAGCTCGAGATAGCCGTGCCCAAGGGCGACGCCC
AGTTCACGCGCCGCTTCCTCGACGCCTTCCGGGACCCCGAGGGCGCCGAGTATATGGTCGACTCTGACCATCCGG
GGTGGCTCGCATGGGGAAAGAGCTTCATGGCGTTCCGATCTCGTCCCGTTGCCTTTATGGCGTACGACGAGGTCG
AGACGGCGGTGCGGGACCAGCTTGGCAGGGTCTTGACGAGGGAGTGGTTGTCGCAGTGCTTCGATTACCTCAAGC
AGGAGCCGCGCGATCAGTGTACGGACAGGTTCCGGATGCAGCATGTCTACCTGCTCATGCACGTCTTCGACCTGA
TGCACTACGGCAATACGGCGGTGACGTTTGACGACGTCAAGGAGCTGACGAGCGGCATCTACGGCGACGGGAGCG
ACAAGCACCAACACCGGGCGACGTCGGAGATCTTGGGGGCGCTGCTGACGGGATCGAGCGACGACCCGCCCGAGA
TCCGGAACCGCGTATGGGGGTTTGCGGCGCCCATGGTGCTGGGCGTCTTCAGGGACGACCTGACGCCGGAGAATC
TGCAGTACTGGCTGGCGTGTCTGCACCTTGTGCTCGACGGCAAGGACCCGCGCCGGTCGCACGAGATCGTCGACG
GGCTCAAGTCGTTCCGGCTCGACATGTCGTCCAACGCGGCCTTCAAGGAGTCGTCCAAGCTGCAGCTCGTCGAGT
TCATAGTGGCCGACGGCGGGTGGCACTTTCGCGACACGGGGCCGATCCAGGAGCACTTGGTGGCGCACATCGACC
ACCCGTACAAGGCGGTGCGCGAGGCCATTGGGCGGCTGCTGTCGGCGCTGGAGAAGTCGCAGTACTACGAGGCGT
TTGAGAGCGTGCCGAAGCTGCTGGAGGAGAACAAGGCGTCGTCGTCGGTCGGCATCCGGCCGTACCAGCCGTCGC
CGGAGCTGACGGCGACCATGACGGGCATCTTTGATCGGCTGGAGCGGTGGCGGCACGAGCGGACGCCGGGGCAGC
AGACGCCGTCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTGGACTGCACGCTGTCGTCGCACGAGT
GCGTGGAGCTGGTGCCCTTCTTCGCGACGCCCTTTGTCGAGCAGCTGCTGCACATGATGGACGTCAAGGAGGACC
CGGAGCTTATGAAGCTGGCCTACCACGTGTACCGACACCTGCCCAACATACCGTTCCGCAAGGGCGAGGACGCGG
GCCTCTGCGAGAGCCTCATCAGGGTCGGGCGGACGGCGGCGAGCTGGCACCAGAGGCTGCGGGCGCTGGTCAACA
TGCAGAGCCTCTACTTCCGGCGCATCTTCATGCTCGGGGCGCCGCAGCGCGACGGGCTCTTCACGGCCGTGTCGG
ACATGCTGAGCGACGCTCAGCTCGAGGTGCGGTCGTGCGCGTCGACGACGCTGGCGGGCATGATCCGGTGCTCTC
CGGGGCAGATCCGGGGCCCCATGGTGGCGCGGCTCAAGCGGCGCTTCGAGGAGGAGCTGCAGCAGAACCCGATGC
CCCGGCGGTCGCAGGGCGGGACGGAGACGCCGGTGGATGTGCAGCGGCAGGTGACGAGGCGACACGCAGCGGTGC
TGGGGCTGGGGGCGCTGATCGAGGCGTTTCCGTACGCGACGCCGCCGCCCGAGTGGATGCCCGAGGTGCTGGCGA
TGCTGGCGCGCAAGGCTTCGGGAGACGCGGGCGTGGTGGGCAAGGCGACCAAGGGGATATTGAGCGAGTTCAAGA
AGACGAGGCAGGACAGCTGGAGCGTGGATCAGAAGGTGAGTGGACGAATGGTGAGAGTTGTGTGAGTGAGCGATG
ATTATGCTGACTTGATGGTCTCTACAGTACTTTACGTCGGAACAGCTGGAGGATTTGGAAGGAGTGCTGTGGAAG
AGCTACTTTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail