Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5537
Gene name
LocationContig_552:2953..4342
Strand-
Gene length (bp)1389
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03595 SLAC1 Voltage-dependent anion channel 1.3E-81 105 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50537|MAE1_SCHPO Malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mae1 PE=1 SV=1 95 460 3.0E-72
sp|O59815|MAE2_SCHPO Putative malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.06 PE=3 SV=1 95 460 4.0E-68
sp|A3QUP1|SSU1_TRIRU Sulfite efflux pump SSU1 OS=Trichophyton rubrum GN=SSU1 PE=2 SV=1 75 450 4.0E-17
sp|A3R044|SSU1_ARTBC Sulfite efflux pump SSU1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SSU1 PE=2 SV=1 75 450 6.0E-17
sp|C5G0E3|SSU1_ARTOC Sulfite efflux pump SSU1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SSU1 PE=3 SV=2 75 450 8.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50537|MAE1_SCHPO Malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mae1 PE=1 SV=1 95 460 3.0E-72
sp|O59815|MAE2_SCHPO Putative malic acid transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.06 PE=3 SV=1 95 460 4.0E-68
sp|A3QUP1|SSU1_TRIRU Sulfite efflux pump SSU1 OS=Trichophyton rubrum GN=SSU1 PE=2 SV=1 75 450 4.0E-17
sp|A3R044|SSU1_ARTBC Sulfite efflux pump SSU1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SSU1 PE=2 SV=1 75 450 6.0E-17
sp|C5G0E3|SSU1_ARTOC Sulfite efflux pump SSU1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SSU1 PE=3 SV=2 75 450 8.0E-16
sp|Q58172|Y762_METJA Uncharacterized transporter MJ0762 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0762 PE=3 SV=1 99 445 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 106 128 22
2 140 162 22
3 177 199 22
4 206 228 22
5 243 265 22
6 277 299 22
7 359 381 22
8 388 410 22
9 420 442 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5537
MSNPAATGQAISAPDLGPWSNSNSSTRRNSLDGSGRSVTEKHRSPSNNGFNNSQLEPGFYYYPGEKAGSSSSNPS
GLGNIEAQPAPVDPNDPDRPRLPLRQRLHHFTWAWYTLSMSTGGLAVLIFAQPHQFMGLRTIGLVVYVINLFIFT
TITILLLTRFFLHPGDLTRSLMHPREGFFVPTFFLAVATIITGTDRYLIPKNDVALVWAISGAFWAYLAFTLVLA
VGQYSYVFASHSFGLQTMMPTWILPIFPIMLSGTIASVIAETQPEIAATPIIVAGLTCQGLGLSVAFMMYAHMIG
RLMQSGLPNREHRPGLFMCVGPPSFTALALIGMANGLPVRPSATAEGTFLDVGVIKTVALLCAIFLWALSLWWFS
IAALAIIQSPPKYFHLGCWAMVFPNSGFTLATIAIGRALGSEPVLWVGTAMSIIILIAYLIVLFFNIRAVVVQDI
MYPNRDEDVEDH*
Coding >Ophun1|5537
ATGAGCAACCCAGCGGCAACAGGCCAGGCCATCTCCGCGCCCGACCTCGGCCCCTGGTCCAACTCCAACTCGTCC
ACCCGCCGGAACTCGCTCGACGGAAGCGGCCGGTCCGTCACGGAGAAGCACCGCTCCCCCAGTAACAATGGCTTC
AACAACTCGCAGCTCGAGCCCGGCTTCTACTACTACCCCGGAGAGAAAGCCGGCAGCTCCAGCAGCAACCCCAGC
GGCCTCGGCAACATCGAAGCCCAACCCGCCCCCGTGGACCCCAACGACCCGGACCGGCCCCGGCTCCCCCTCCGA
CAGCGTCTCCATCACTTCACCTGGGCGTGGTACACGCTCTCCATGAGCACCGGCGGCCTCGCCGTCCTCATCTTC
GCGCAACCCCATCAATTCATGGGTCTCCGGACCATCGGTCTCGTCGTCTACGTCATCAACCTCTTCATCTTCACC
ACCATCACCATCCTCCTCCTCACCCGCTTCTTCCTCCACCCCGGAGACCTGACCCGATCCCTGATGCATCCCAGA
GAAGGCTTCTTCGTCCCCACCTTCTTCCTCGCCGTCGCCACCATCATCACAGGAACGGACCGCTATCTCATCCCA
AAGAACGACGTTGCTCTCGTATGGGCCATCTCAGGCGCCTTCTGGGCCTACCTCGCCTTCACCCTCGTCCTCGCC
GTCGGCCAGTACAGCTACGTCTTCGCCTCCCACAGCTTCGGCCTCCAGACCATGATGCCCACCTGGATCCTCCCC
ATCTTCCCCATCATGCTCTCCGGAACCATCGCCTCCGTCATCGCCGAGACGCAGCCCGAGATCGCCGCCACGCCC
ATCATCGTCGCCGGCCTCACCTGTCAGGGCCTGGGCCTATCCGTCGCCTTCATGATGTACGCCCACATGATCGGC
CGTCTCATGCAATCCGGTCTCCCCAATCGGGAGCACCGTCCAGGCCTCTTCATGTGCGTCGGACCACCGTCCTTC
ACCGCTCTGGCCCTCATCGGTATGGCCAACGGTCTTCCCGTCAGGCCGAGCGCCACCGCCGAGGGGACCTTTCTC
GACGTCGGCGTCATCAAGACCGTGGCCCTCTTGTGCGCCATCTTCCTCTGGGCCTTGAGCCTGTGGTGGTTCAGC
ATCGCCGCCCTGGCCATCATCCAGTCTCCGCCCAAGTACTTCCACCTGGGCTGCTGGGCCATGGTCTTTCCCAAC
AGCGGCTTCACGCTGGCGACGATTGCCATCGGCAGAGCGCTGGGGAGCGAGCCGGTGTTATGGGTAGGGACGGCC
ATGTCCATCATCATCCTCATCGCCTATCTGATTGTCCTCTTCTTTAATATCCGGGCCGTTGTCGTGCAGGACATA
ATGTATCCGAACCGGGATGAGGATGTGGAAGACCATTGA
Transcript >Ophun1|5537
ATGAGCAACCCAGCGGCAACAGGCCAGGCCATCTCCGCGCCCGACCTCGGCCCCTGGTCCAACTCCAACTCGTCC
ACCCGCCGGAACTCGCTCGACGGAAGCGGCCGGTCCGTCACGGAGAAGCACCGCTCCCCCAGTAACAATGGCTTC
AACAACTCGCAGCTCGAGCCCGGCTTCTACTACTACCCCGGAGAGAAAGCCGGCAGCTCCAGCAGCAACCCCAGC
GGCCTCGGCAACATCGAAGCCCAACCCGCCCCCGTGGACCCCAACGACCCGGACCGGCCCCGGCTCCCCCTCCGA
CAGCGTCTCCATCACTTCACCTGGGCGTGGTACACGCTCTCCATGAGCACCGGCGGCCTCGCCGTCCTCATCTTC
GCGCAACCCCATCAATTCATGGGTCTCCGGACCATCGGTCTCGTCGTCTACGTCATCAACCTCTTCATCTTCACC
ACCATCACCATCCTCCTCCTCACCCGCTTCTTCCTCCACCCCGGAGACCTGACCCGATCCCTGATGCATCCCAGA
GAAGGCTTCTTCGTCCCCACCTTCTTCCTCGCCGTCGCCACCATCATCACAGGAACGGACCGCTATCTCATCCCA
AAGAACGACGTTGCTCTCGTATGGGCCATCTCAGGCGCCTTCTGGGCCTACCTCGCCTTCACCCTCGTCCTCGCC
GTCGGCCAGTACAGCTACGTCTTCGCCTCCCACAGCTTCGGCCTCCAGACCATGATGCCCACCTGGATCCTCCCC
ATCTTCCCCATCATGCTCTCCGGAACCATCGCCTCCGTCATCGCCGAGACGCAGCCCGAGATCGCCGCCACGCCC
ATCATCGTCGCCGGCCTCACCTGTCAGGGCCTGGGCCTATCCGTCGCCTTCATGATGTACGCCCACATGATCGGC
CGTCTCATGCAATCCGGTCTCCCCAATCGGGAGCACCGTCCAGGCCTCTTCATGTGCGTCGGACCACCGTCCTTC
ACCGCTCTGGCCCTCATCGGTATGGCCAACGGTCTTCCCGTCAGGCCGAGCGCCACCGCCGAGGGGACCTTTCTC
GACGTCGGCGTCATCAAGACCGTGGCCCTCTTGTGCGCCATCTTCCTCTGGGCCTTGAGCCTGTGGTGGTTCAGC
ATCGCCGCCCTGGCCATCATCCAGTCTCCGCCCAAGTACTTCCACCTGGGCTGCTGGGCCATGGTCTTTCCCAAC
AGCGGCTTCACGCTGGCGACGATTGCCATCGGCAGAGCGCTGGGGAGCGAGCCGGTGTTATGGGTAGGGACGGCC
ATGTCCATCATCATCCTCATCGCCTATCTGATTGTCCTCTTCTTTAATATCCGGGCCGTTGTCGTGCAGGACATA
ATGTATCCGAACCGGGATGAGGATGTGGAAGACCATTGA
Gene >Ophun1|5537
ATGAGCAACCCAGCGGCAACAGGCCAGGCCATCTCCGCGCCCGACCTCGGCCCCTGGTCCAACTCCAACTCGTCC
ACCCGCCGGAACTCGCTCGACGGAAGCGGCCGGTCCGTCACGGAGAAGCACCGCTCCCCCAGTAACAATGGCTTC
AACAACTCGCAGCTCGAGCCCGGCTTCTACTACTACCCCGGAGAGAAAGCCGGCAGCTCCAGCAGCAACCCCAGC
GGCCTCGGCAACATCGAAGCCCAACCCGCCCCCGTGGACCCCAACGACCCGGACCGGCCCCGGCTCCCCCTCCGA
CAGCGTCTCCATCACTTCACCTGGGCGTGGTACACGCTCTCCATGAGCACCGGCGGCCTCGCCGTCCTCATCTTC
GCGCAACCCCATCAATTCATGGGTCTCCGGACCATCGGTCTCGTCGTCTACGTCATCAACCTCTTCATCTTCACC
ACCATCACCATCCTCCTCCTCACCCGCTTCTTCCTCCACCCCGGAGACCTGACCCGATCCCTGATGCATCCCAGA
GAAGGCTTCTTCGTCCCCACCTTCTTCCTCGCCGTCGCCACCATCATCACAGGAACGGACCGCTATCTCATCCCA
AAGAACGACGTTGCTCTCGTATGGGCCATCTCAGGCGCCTTCTGGGCCTACCTCGCCTTCACCCTCGTCCTCGCC
GTCGGCCAGTACAGCTACGTCTTCGCCTCCCACAGCTTCGGCCTCCAGACCATGATGCCCACCTGGATCCTCCCC
ATCTTCCCCATCATGCTCTCCGGAACCATCGCCTCCGTCATCGCCGAGACGCAGCCCGAGATCGCCGCCACGCCC
ATCATCGTCGCCGGCCTCACCTGTCAGGGCCTGGGCCTATCCGTCGCCTTCATGATGTACGCCCACATGATCGGC
CGTCTCATGCAATCCGGTCTCCCCAATCGGGAGCACCGTCCAGGCCTCTTCATGTGCGTCGGACCACCGTCCTTC
ACCGCTCTGGCCCTCATCGGTATGGCCAACGGTCTTCCCGTCAGGCCGAGCGCCACCGCCGAGGGGACCTTTCTC
GACGTCGGCGTCATCAAGACCGTGGCCCTCTTGTGCGCCATCTTCCTCTGGGCCTTGAGCCTGTGGTGGTTCAGC
ATCGCCGCCCTGGCCATCATCCAGTCTCCGCCCAAGTACTTCCACCTGGGCTGCTGGGCCATGGTCTTTCCCAAC
AGCGGCTTCACGCTGGCGACGATTGCCATCGGCAGAGCGCTGGGGAGCGAGCCGGTGTTATGGGTAGGGACGGCC
ATGTCCATCATCATCCTCATCGCCTATCTGATTGTCCTCTTCTTTAATATCCGGGCCGTTGTCGTGCAGGACATA
ATGTATCCGAACCGGGATGAGGATGTGGAAGACCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail