Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5532
Gene name
LocationContig_551:22..5186
Strand-
Gene length (bp)5164
Transcript length (bp)4053
Coding sequence length (bp)4053
Protein length (aa) 1351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02696 SelO Protein adenylyltransferase SelO 2.0E-125 50 580
PF00384 Molybdopterin Molybdopterin oxidoreductase 3.2E-65 894 1218
PF10588 NADH-G_4Fe-4S_3 NADH-ubiquinone oxidoreductase-G iron-sulfur binding region 8.5E-17 704 741
PF13510 Fer2_4 2Fe-2S iron-sulfur cluster binding domain 2.2E-15 626 697
PF09326 NADH_dhqG_C NADH-ubiquinone oxidoreductase subunit G, C-terminal 2.2E-10 1250 1292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24918|NDUS1_NEUCR NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo78 PE=1 SV=2 602 1296 0.0E+00
sp|P15690|NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus GN=NDUFS1 PE=1 SV=1 603 1296 0.0E+00
sp|P28331|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3 603 1296 0.0E+00
sp|P0CB68|NDUS1_PONPY NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo pygmaeus GN=NDUFS1 PE=2 SV=1 603 1296 0.0E+00
sp|Q0MQG2|NDUS1_PANTR NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pan troglodytes GN=NDUFS1 PE=2 SV=1 603 1296 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24918|NDUS1_NEUCR NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo78 PE=1 SV=2 602 1296 0.0E+00
sp|P15690|NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus GN=NDUFS1 PE=1 SV=1 603 1296 0.0E+00
sp|P28331|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3 603 1296 0.0E+00
sp|P0CB68|NDUS1_PONPY NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo pygmaeus GN=NDUFS1 PE=2 SV=1 603 1296 0.0E+00
sp|Q0MQG2|NDUS1_PANTR NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pan troglodytes GN=NDUFS1 PE=2 SV=1 603 1296 0.0E+00
sp|Q4R6K9|NDUS1_MACFA NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Macaca fascicularis GN=NDUFS1 PE=2 SV=1 603 1296 0.0E+00
sp|Q0MQG1|NDUS1_GORGO NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS1 PE=2 SV=1 603 1296 0.0E+00
sp|P0CB67|NDUS1_PONAB NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo abelii GN=NDUFS1 PE=2 SV=1 603 1296 0.0E+00
sp|Q91VD9|NDUS1_MOUSE NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus GN=Ndufs1 PE=1 SV=2 628 1296 0.0E+00
sp|Q66HF1|NDUS1_RAT NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Rattus norvegicus GN=Ndufs1 PE=1 SV=1 628 1296 0.0E+00
sp|O21241|NDUS1_RECAM NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Reclinomonas americana GN=NAD11 PE=3 SV=1 628 1296 0.0E+00
sp|Q43644|NDUS1_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Solanum tuberosum PE=2 SV=1 628 1292 0.0E+00
sp|Q94511|NDUS1_DROME NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Drosophila melanogaster GN=ND-75 PE=2 SV=3 608 1292 0.0E+00
sp|Q9FGI6|NDUS1_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Arabidopsis thaliana GN=EMB1467 PE=1 SV=2 628 1292 0.0E+00
sp|Q1RKD2|NUOG_RICBR NADH-quinone oxidoreductase subunit G OS=Rickettsia bellii (strain RML369-C) GN=nuoG PE=3 SV=1 628 1296 0.0E+00
sp|Q4UK22|NUOG_RICFE NADH-quinone oxidoreductase subunit G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoG PE=3 SV=1 628 1296 0.0E+00
sp|Q92G92|NUOG_RICCN NADH-quinone oxidoreductase subunit G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoG PE=3 SV=2 628 1296 0.0E+00
sp|Q9ZCF6|NUOG_RICPR NADH-quinone oxidoreductase subunit G OS=Rickettsia prowazekii (strain Madrid E) GN=nuoG PE=3 SV=1 628 1296 0.0E+00
sp|Q68VV2|NUOG_RICTY NADH-quinone oxidoreductase subunit G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoG PE=3 SV=1 628 1296 0.0E+00
sp|P29915|NQO3_PARDE NADH-quinone oxidoreductase chain 3 OS=Paracoccus denitrificans GN=nqo3 PE=1 SV=4 629 1292 4.0E-178
sp|Q37373|NDUS1_ACACA NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Acanthamoeba castellanii GN=NAD11 PE=3 SV=1 627 1243 9.0E-144
sp|O13890|YE35_SCHPO UPF0061 protein C20G4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G4.05c PE=3 SV=1 6 596 8.0E-130
sp|Q34312|NDUS1_DICDI NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Dictyostelium discoideum GN=nad11 PE=3 SV=1 627 1289 2.0E-114
sp|Q2LCP5|NDUS1_DICCI NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Dictyostelium citrinum GN=nad11 PE=3 SV=2 627 1292 6.0E-113
sp|Q08968|FMP40_YEAST UPF0061 protein FMP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP40 PE=1 SV=1 41 586 1.0E-105
sp|Q5NYD9|Y3800_AROAE UPF0061 protein AZOSEA38000 OS=Aromatoleum aromaticum (strain EbN1) GN=AZOSEA38000 PE=3 SV=1 6 615 2.0E-82
sp|B0RS12|Y1894_XANCB UPF0061 protein xcc-b100_1894 OS=Xanthomonas campestris pv. campestris (strain B100) GN=xcc-b100_1894 PE=3 SV=1 46 587 3.0E-82
sp|C1AED7|Y3822_GEMAT UPF0061 protein GAU_3822 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=GAU_3822 PE=3 SV=1 14 615 7.0E-81
sp|Q8P8F8|Y2284_XANCP UPF0061 protein XCC2284 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC2284 PE=3 SV=1 46 587 1.0E-80
sp|Q4UVM9|Y1831_XANC8 UPF0061 protein XC_1831 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=XC_1831 PE=3 SV=1 46 587 1.0E-80
sp|Q2Y8V8|Y1510_NITMU UPF0061 protein Nmul_A1510 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=Nmul_A1510 PE=3 SV=1 14 615 2.0E-80
sp|Q7UKT5|Y9953_RHOBA UPF0061 protein RB9953 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=RB9953 PE=3 SV=1 8 598 4.0E-80
sp|Q5GZ99|Y2718_XANOR UPF0061 protein XOO2718 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=XOO2718 PE=3 SV=2 48 590 2.0E-78
sp|Q2P2A9|Y2563_XANOM UPF0061 protein XOO2563 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=XOO2563 PE=3 SV=1 48 590 2.0E-78
sp|B2SHR2|Y396_XANOP UPF0061 protein PXO_00396 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=PXO_00396 PE=3 SV=1 48 590 3.0E-78
sp|Q478G7|Y4038_DECAR UPF0061 protein Daro_4038 OS=Dechloromonas aromatica (strain RCB) GN=Daro_4038 PE=3 SV=1 47 587 5.0E-78
sp|Q8PJY5|Y2392_XANAC UPF0061 protein XAC2392 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=XAC2392 PE=3 SV=1 46 590 6.0E-78
sp|Q8XYL0|Y1748_RALSO UPF0061 protein RSc1748 OS=Ralstonia solanacearum (strain GMI1000) GN=RSc1748 PE=3 SV=1 61 590 7.0E-78
sp|Q3BSE3|Y2589_XANC5 UPF0061 protein XCV2589 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=XCV2589 PE=3 SV=2 48 590 1.0E-77
sp|C4LAV8|Y683_TOLAT UPF0061 protein Tola_0683 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=Tola_0683 PE=3 SV=1 14 600 2.0E-77
sp|A5FG48|Y2793_FLAJ1 UPF0061 protein Fjoh_2793 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=Fjoh_2793 PE=3 SV=1 6 587 2.0E-74
sp|Q1H0D2|Y1788_METFK UPF0061 protein Mfla_1788 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=Mfla_1788 PE=3 SV=1 14 615 3.0E-74
sp|Q472B7|Y1396_CUPPJ UPF0061 protein Reut_A1396 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A1396 PE=3 SV=1 49 587 6.0E-74
sp|Q39FG3|Y5209_BURL3 UPF0061 protein Bcep18194_A5209 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=Bcep18194_A5209 PE=3 SV=2 47 587 6.0E-73
sp|Q0BEH1|Y1896_BURCM UPF0061 protein Bamb_1896 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_1896 PE=3 SV=1 47 587 2.0E-72
sp|Q1BH70|Y6171_BURCA UPF0061 protein Bcen_6171 OS=Burkholderia cenocepacia (strain AU 1054) GN=Bcen_6171 PE=3 SV=1 47 587 2.0E-72
sp|A0K832|Y1908_BURCH UPF0061 protein Bcen2424_1908 OS=Burkholderia cenocepacia (strain HI2424) GN=Bcen2424_1908 PE=3 SV=1 47 587 2.0E-72
sp|B1YRN5|Y1826_BURA4 UPF0061 protein BamMC406_1826 OS=Burkholderia ambifaria (strain MC40-6) GN=BamMC406_1826 PE=3 SV=1 47 587 2.0E-72
sp|Q135R4|Y2948_RHOPS UPF0061 protein RPD_2948 OS=Rhodopseudomonas palustris (strain BisB5) GN=RPD_2948 PE=3 SV=1 47 587 2.0E-72
sp|A9AJS7|Y1877_BURM1 UPF0061 protein Bmul_1366/BMULJ_01877 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=Bmul_1366 PE=3 SV=1 47 587 5.0E-72
sp|B4EBK8|Y1944_BURCJ UPF0061 protein BceJ2315_19440 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=BceJ2315_19440 PE=3 SV=1 47 587 5.0E-72
sp|B1JTT5|Y1931_BURCC UPF0061 protein Bcenmc03_1931 OS=Burkholderia cenocepacia (strain MC0-3) GN=Bcenmc03_1931 PE=3 SV=1 47 587 6.0E-72
sp|Q1DDZ9|Y863_MYXXD UPF0061 protein MXAN_0863 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_0863 PE=3 SV=1 53 596 9.0E-72
sp|A4G5V4|Y1735_HERAR UPF0061 protein HEAR1735 OS=Herminiimonas arsenicoxydans GN=HEAR1735 PE=3 SV=1 48 587 2.0E-71
sp|A1K5T6|Y1574_AZOSB UPF0061 protein azo1574 OS=Azoarcus sp. (strain BH72) GN=azo1574 PE=3 SV=1 14 615 6.0E-71
sp|B5XQE2|Y2154_KLEP3 UPF0061 protein KPK_2154 OS=Klebsiella pneumoniae (strain 342) GN=KPK_2154 PE=3 SV=1 100 599 1.0E-70
sp|A6TAH1|Y2131_KLEP7 UPF0061 protein KPN78578_21310 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=KPN78578_21310 PE=3 SV=1 100 599 1.0E-70
sp|A4JEZ0|Y1840_BURVG UPF0061 protein Bcep1808_1840 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=Bcep1808_1840 PE=3 SV=1 47 587 1.0E-70
sp|Q87A39|Y1992_XYLFT UPF0061 protein PD_1992 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1992 PE=3 SV=1 14 615 2.0E-70
sp|Q2KAV8|Y1223_RHIEC UPF0061 protein RHE_CH01223 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH01223 PE=3 SV=2 49 604 2.0E-70
sp|A9IT50|Y3040_BORPD UPF0061 protein Bpet3040 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=Bpet3040 PE=3 SV=1 48 574 2.0E-70
sp|Q3SEY2|Y1019_THIDA UPF0061 protein Tbd_1019 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=Tbd_1019 PE=3 SV=1 47 587 3.0E-70
sp|B7NTS5|YDIU_ECO7I UPF0061 protein YdiU OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ydiU PE=3 SV=1 100 587 5.0E-70
sp|Q2IX60|Y2495_RHOP2 UPF0061 protein RPB_2495 OS=Rhodopseudomonas palustris (strain HaA2) GN=RPB_2495 PE=3 SV=1 49 587 5.0E-70
sp|C3KBV5|Y444_PSEFS UPF0061 protein PFLU_0444 OS=Pseudomonas fluorescens (strain SBW25) GN=PFLU_0444 PE=3 SV=1 47 590 6.0E-70
sp|A7MNZ6|Y2105_CROS8 UPF0061 protein ESA_02105 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ESA_02105 PE=3 SV=1 100 592 7.0E-70
sp|Q11T54|Y2147_CYTH3 UPF0061 protein CHU_2147 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=CHU_2147 PE=3 SV=1 12 585 7.0E-70
sp|Q9PA99|Y2619_XYLFA UPF0061 protein XF_2619 OS=Xylella fastidiosa (strain 9a5c) GN=XF_2619 PE=3 SV=1 46 615 8.0E-70
sp|Q1LVN8|SELO_DANRE Selenoprotein O OS=Danio rerio GN=selo PE=3 SV=2 45 497 8.0E-70
sp|Q9XAR0|NUOG_STRCO NADH-quinone oxidoreductase subunit G OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoG PE=3 SV=1 628 1018 1.0E-69
sp|B1LE24|YDIU_ECOSM UPF0061 protein YdiU OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ydiU PE=3 SV=1 100 587 2.0E-69
sp|A4W9N5|Y1736_ENT38 UPF0061 protein Ent638_1736 OS=Enterobacter sp. (strain 638) GN=Ent638_1736 PE=3 SV=1 49 587 2.0E-69
sp|B5ZUP2|Y857_RHILW UPF0061 protein Rleg2_0857 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=Rleg2_0857 PE=3 SV=1 104 590 4.0E-69
sp|B7L6H9|YDIU_ECO55 UPF0061 protein YdiU OS=Escherichia coli (strain 55989 / EAEC) GN=ydiU PE=3 SV=1 48 587 4.0E-69
sp|Q1MJK8|Y1355_RHIL3 UPF0061 protein RL1355 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL1355 PE=3 SV=1 104 590 5.0E-69
sp|B7LQ82|YDIU_ESCF3 UPF0061 protein YdiU OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ydiU PE=3 SV=1 100 599 5.0E-69
sp|P77649|YDIU_ECOLI UPF0061 protein YdiU OS=Escherichia coli (strain K12) GN=ydiU PE=3 SV=1 100 587 2.0E-68
sp|B1XG13|YDIU_ECODH UPF0061 protein YdiU OS=Escherichia coli (strain K12 / DH10B) GN=ydiU PE=3 SV=1 100 587 2.0E-68
sp|C4ZYG8|YDIU_ECOBW UPF0061 protein YdiU OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ydiU PE=3 SV=1 100 587 2.0E-68
sp|Q3JRF1|Y2457_BURP1 UPF0061 protein BURPS1710b_2457 OS=Burkholderia pseudomallei (strain 1710b) GN=BURPS1710b_2457 PE=3 SV=1 16 587 2.0E-68
sp|Q63V22|Y1422_BURPS UPF0061 protein BPSL1422 OS=Burkholderia pseudomallei (strain K96243) GN=BPSL1422 PE=3 SV=2 16 587 2.0E-68
sp|B7GIH1|Y334_ANOFW UPF0061 protein Aflv_0334 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=Aflv_0334 PE=3 SV=1 49 585 2.0E-68
sp|A3NW79|Y2336_BURP0 UPF0061 protein BURPS1106A_2336 OS=Burkholderia pseudomallei (strain 1106a) GN=BURPS1106A_2336 PE=3 SV=1 16 587 2.0E-68
sp|B6I8R1|YDIU_ECOSE UPF0061 protein YdiU OS=Escherichia coli (strain SE11) GN=ydiU PE=3 SV=1 100 587 3.0E-68
sp|B2T421|Y1924_BURPP UPF0061 protein Bphyt_1924 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_1924 PE=3 SV=1 49 587 3.0E-68
sp|A7ZMH3|YDIU_ECO24 UPF0061 protein YdiU OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ydiU PE=3 SV=1 48 587 4.0E-68
sp|B1J2K5|Y398_PSEPW UPF0061 protein PputW619_0398 OS=Pseudomonas putida (strain W619) GN=PputW619_0398 PE=3 SV=1 47 590 5.0E-68
sp|A2SBI7|Y5674_BURM9 UPF0061 protein BMA10229_A3374 OS=Burkholderia mallei (strain NCTC 10229) GN=BMA10229_A3374 PE=3 SV=2 16 587 5.0E-68
sp|B7N544|YDIU_ECOLU UPF0061 protein YdiU OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ydiU PE=3 SV=1 100 587 6.0E-68
sp|Q1LM83|Y1864_CUPMC UPF0061 protein Rmet_1864 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_1864 PE=3 SV=1 49 587 8.0E-68
sp|A8A0P8|YDIU_ECOHS UPF0061 protein YdiU OS=Escherichia coli O9:H4 (strain HS) GN=ydiU PE=3 SV=1 100 587 9.0E-68
sp|B1IQ50|YDIU_ECOLC UPF0061 protein YdiU OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ydiU PE=3 SV=1 100 587 1.0E-67
sp|B2U355|YDIU_SHIB3 UPF0061 protein YdiU OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ydiU PE=3 SV=1 100 587 1.0E-67
sp|B7MVI5|YDIU_ECO81 UPF0061 protein YdiU OS=Escherichia coli O81 (strain ED1a) GN=ydiU PE=3 SV=1 100 587 2.0E-67
sp|Q3Z253|YDIU_SHISS UPF0061 protein YdiU OS=Shigella sonnei (strain Ss046) GN=ydiU PE=3 SV=1 100 587 2.0E-67
sp|A4TIN1|Y737_YERPP UPF0061 protein YPDSF_0737 OS=Yersinia pestis (strain Pestoides F) GN=YPDSF_0737 PE=3 SV=1 49 588 2.0E-67
sp|B2K5K6|Y2396_YERPB UPF0061 protein YPTS_2396 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=YPTS_2396 PE=3 SV=1 49 588 2.0E-67
sp|Q66A11|Y2321_YERPS UPF0061 protein YPTB2321 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=YPTB2321 PE=3 SV=1 49 588 2.0E-67
sp|B1JJ37|Y1840_YERPY UPF0061 protein YPK_1840 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=YPK_1840 PE=3 SV=1 49 588 2.0E-67
sp|B9JBH4|Y1451_AGRRK UPF0061 protein Arad_1451 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=Arad_1451 PE=3 SV=1 49 587 3.0E-67
sp|A7FHI1|Y1734_YERP3 UPF0061 protein YpsIP31758_1734 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=YpsIP31758_1734 PE=3 SV=1 49 588 3.0E-67
sp|Q9DBC0|SELO_MOUSE Selenoprotein O OS=Mus musculus GN=Selo PE=1 SV=4 14 616 3.0E-67
sp|C5CNS8|Y2935_VARPS UPF0061 protein Vapar_2935 OS=Variovorax paradoxus (strain S110) GN=Vapar_2935 PE=3 SV=1 39 471 3.0E-67
sp|Q321G3|YDIU_SHIBS UPF0061 protein YdiU OS=Shigella boydii serotype 4 (strain Sb227) GN=ydiU PE=3 SV=1 100 587 4.0E-67
sp|Q62JM7|Y1440_BURMA UPF0061 protein BMA1440 OS=Burkholderia mallei (strain ATCC 23344) GN=BMA1440 PE=3 SV=2 48 587 4.0E-67
sp|Q0THC2|YDIU_ECOL5 UPF0061 protein YdiU OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ydiU PE=3 SV=1 100 587 4.0E-67
sp|B7US45|YDIU_ECO27 UPF0061 protein YdiU OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ydiU PE=3 SV=1 100 587 4.0E-67
sp|Q6D646|Y1842_PECAS UPF0061 protein ECA1842 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ECA1842 PE=3 SV=1 49 593 7.0E-67
sp|C6DKP3|Y2463_PECCP UPF0061 protein PC1_2463 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=PC1_2463 PE=3 SV=1 49 588 7.0E-67
sp|Q13YZ6|Y2155_BURXL UPF0061 protein Bxeno_A2155 OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A2155 PE=3 SV=1 49 587 7.0E-67
sp|Q83L33|YDIU_SHIFL UPF0061 protein YdiU OS=Shigella flexneri GN=ydiU PE=3 SV=1 100 587 7.0E-67
sp|Q21VU1|Y2395_RHOFT UPF0061 protein Rfer_2395 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_2395 PE=3 SV=1 103 587 1.0E-66
sp|Q1RB89|YDIU_ECOUT UPF0061 protein YdiU OS=Escherichia coli (strain UTI89 / UPEC) GN=ydiU PE=3 SV=1 100 587 2.0E-66
sp|Q8FH30|YDIU_ECOL6 UPF0061 protein YdiU OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydiU PE=3 SV=1 100 587 2.0E-66
sp|A1ABP2|YDIU_ECOK1 UPF0061 protein YdiU OS=Escherichia coli O1:K1 / APEC GN=ydiU PE=3 SV=1 100 587 2.0E-66
sp|B7MAR7|YDIU_ECO45 UPF0061 protein YdiU OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ydiU PE=3 SV=1 100 587 2.0E-66
sp|Q215P8|Y2335_RHOPB UPF0061 protein RPC_2335 OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_2335 PE=3 SV=1 47 590 4.0E-66
sp|B5F7F0|YDIU_SALA4 UPF0061 protein YdiU OS=Salmonella agona (strain SL483) GN=ydiU PE=3 SV=1 100 587 4.0E-66
sp|Q8ZPS5|YDIU_SALTY UPF0061 protein YdiU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydiU PE=3 SV=1 100 599 4.0E-66
sp|B5YPZ4|YDIU_ECO5E UPF0061 protein YdiU OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ydiU PE=3 SV=1 100 587 4.0E-66
sp|Q8X5W3|YDIU_ECO57 UPF0061 protein YdiU OS=Escherichia coli O157:H7 GN=ydiU PE=3 SV=1 100 587 4.0E-66
sp|B3PTN1|Y1310_RHIE6 UPF0061 protein RHECIAT_CH0001310 OS=Rhizobium etli (strain CIAT 652) GN=RHECIAT_CH0001310 PE=3 SV=1 104 587 5.0E-66
sp|B2TJM9|Y1414_CLOBB UPF0061 protein CLL_A1414 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=CLL_A1414 PE=3 SV=1 49 588 6.0E-66
sp|B4TGI2|YDIU_SALHS UPF0061 protein YdiU OS=Salmonella heidelberg (strain SL476) GN=ydiU PE=3 SV=1 100 587 6.0E-66
sp|B5BA30|YDIU_SALPK UPF0061 protein YdiU OS=Salmonella paratyphi A (strain AKU_12601) GN=ydiU PE=3 SV=1 100 587 9.0E-66
sp|Q5PH84|YDIU_SALPA UPF0061 protein YdiU OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ydiU PE=3 SV=1 100 587 9.0E-66
sp|Q8Z6I8|YDIU_SALTI UPF0061 protein YdiU OS=Salmonella typhi GN=ydiU PE=3 SV=1 100 587 1.0E-65
sp|A9N229|YDIU_SALPB UPF0061 protein YdiU OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ydiU PE=3 SV=1 100 587 1.0E-65
sp|B4T4P0|YDIU_SALNS UPF0061 protein YdiU OS=Salmonella newport (strain SL254) GN=ydiU PE=3 SV=1 100 587 2.0E-65
sp|B5FJ96|YDIU_SALDC UPF0061 protein YdiU OS=Salmonella dublin (strain CT_02021853) GN=ydiU PE=3 SV=1 100 587 2.0E-65
sp|B4TUG2|YDIU_SALSV UPF0061 protein YdiU OS=Salmonella schwarzengrund (strain CVM19633) GN=ydiU PE=3 SV=1 100 587 3.0E-65
sp|B5QVV6|YDIU_SALEP UPF0061 protein YdiU OS=Salmonella enteritidis PT4 (strain P125109) GN=ydiU PE=3 SV=1 100 587 3.0E-65
sp|B0KN22|Y5118_PSEPG UPF0061 protein PputGB1_5118 OS=Pseudomonas putida (strain GB-1) GN=PputGB1_5118 PE=3 SV=1 47 590 3.0E-65
sp|Q4ZZ58|Y494_PSEU2 UPF0061 protein Psyr_0494 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_0494 PE=3 SV=1 47 590 4.0E-65
sp|C0ZD92|Y2774_BREBN UPF0061 protein BBR47_27740 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=BBR47_27740 PE=3 SV=1 48 585 5.0E-65
sp|Q92RB2|Y982_RHIME UPF0061 protein R00982 OS=Rhizobium meliloti (strain 1021) GN=R00982 PE=3 SV=1 49 590 6.0E-65
sp|Q9K5Z6|Y3939_BACHD UPF0061 protein BH3939 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH3939 PE=3 SV=1 49 588 6.0E-65
sp|B1ZBT6|Y5402_METPB UPF0061 protein Mpop_5402 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=Mpop_5402 PE=3 SV=1 47 587 7.0E-65
sp|A6TPX1|Y2079_ALKMQ UPF0061 protein Amet_2079 OS=Alkaliphilus metalliredigens (strain QYMF) GN=Amet_2079 PE=3 SV=1 49 588 9.0E-65
sp|A9MEQ9|YDIU_SALAR UPF0061 protein YdiU OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ydiU PE=3 SV=1 100 587 1.0E-64
sp|Q6N5D5|Y3044_RHOPA UPF0061 protein RPA3044 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=RPA3044 PE=3 SV=1 49 587 2.0E-64
sp|A9VNN2|Y3221_BACWK UPF0061 protein BcerKBAB4_3221 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_3221 PE=3 SV=1 48 588 2.0E-64
sp|Q9BVL4|SELO_HUMAN Selenoprotein O OS=Homo sapiens GN=SELO PE=2 SV=3 41 590 2.0E-64
sp|Q15NS9|Y3959_PSEA6 UPF0061 protein Patl_3959 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=Patl_3959 PE=3 SV=1 107 586 2.0E-64
sp|C0Q635|YDIU_SALPC UPF0061 protein YdiU OS=Salmonella paratyphi C (strain RKS4594) GN=ydiU PE=3 SV=1 100 587 2.0E-64
sp|A5WAA1|Y4941_PSEP1 UPF0061 protein Pput_4941 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=Pput_4941 PE=3 SV=1 47 590 3.0E-64
sp|Q733Y5|Y3522_BACC1 UPF0061 protein BCE_3522 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_3522 PE=3 SV=1 48 585 3.0E-64
sp|Q2SWN8|Y2140_BURTA UPF0061 protein BTH_I2140 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=BTH_I2140 PE=3 SV=1 16 474 3.0E-64
sp|Q87VB1|Y5028_PSESM UPF0061 protein PSPTO_5028 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_5028 PE=3 SV=1 47 590 3.0E-64
sp|Q48P81|Y485_PSE14 UPF0061 protein PSPPH_0485 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_0485 PE=3 SV=1 47 590 4.0E-64
sp|B3Q9Q2|Y3454_RHOPT UPF0061 protein Rpal_3454 OS=Rhodopseudomonas palustris (strain TIE-1) GN=Rpal_3454 PE=3 SV=1 49 587 5.0E-64
sp|Q87R88|Y909_VIBPA UPF0061 protein VP0909 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VP0909 PE=3 SV=1 48 586 5.0E-64
sp|B8GQ83|Y1192_THISH UPF0061 protein Tgr7_1192 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=Tgr7_1192 PE=3 SV=1 55 588 7.0E-64
sp|Q1QUL6|Y2495_CHRSD UPF0061 protein Csal_2495 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=Csal_2495 PE=3 SV=1 49 570 7.0E-64
sp|A5EIE5|Y3863_BRASB UPF0061 protein BBta_3863 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_3863 PE=3 SV=1 47 587 8.0E-64
sp|A4YTC3|Y3358_BRASO UPF0061 protein BRADO3358 OS=Bradyrhizobium sp. (strain ORS278) GN=BRADO3358 PE=3 SV=1 47 587 9.0E-64
sp|B7KWN1|Y5348_METC4 UPF0061 protein Mchl_5348 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=Mchl_5348 PE=3 SV=1 49 587 1.0E-63
sp|Q60B95|Y585_METCA UPF0061 protein MCA0585 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=MCA0585 PE=3 SV=1 103 587 1.0E-63
sp|Q88CW2|Y5068_PSEPK UPF0061 protein PP_5068 OS=Pseudomonas putida (strain KT2440) GN=PP_5068 PE=3 SV=2 47 590 1.0E-63
sp|Q57PU1|YDIU_SALCH UPF0061 protein YdiU OS=Salmonella choleraesuis (strain SC-B67) GN=ydiU PE=3 SV=1 100 587 1.0E-63
sp|B7HZ82|Y3529_BACC7 UPF0061 protein BCAH187_A3529 OS=Bacillus cereus (strain AH187) GN=BCAH187_A3529 PE=3 SV=1 48 585 1.0E-63
sp|B9ITN8|Y3304_BACCQ UPF0061 protein BCQ_3304 OS=Bacillus cereus (strain Q1) GN=BCQ_3304 PE=3 SV=1 48 585 1.0E-63
sp|Q12AE5|Y2581_POLSJ UPF0061 protein Bpro_2581 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=Bpro_2581 PE=3 SV=1 49 593 2.0E-63
sp|C3P3V9|Y3596_BACAA UPF0061 protein BAA_3596 OS=Bacillus anthracis (strain A0248) GN=BAA_3596 PE=3 SV=1 48 585 2.0E-63
sp|Q81YI0|Y3567_BACAN UPF0061 protein BA_3567/GBAA_3567/BAS3307 OS=Bacillus anthracis GN=BA_3567 PE=3 SV=1 48 585 2.0E-63
sp|C3LAB5|Y1065_BACAC UPF0061 protein BAMEG_1065 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=BAMEG_1065 PE=3 SV=1 48 585 2.0E-63
sp|B7JH71|Y3523_BACC0 UPF0061 protein BCAH820_3523 OS=Bacillus cereus (strain AH820) GN=BCAH820_3523 PE=3 SV=1 48 585 2.0E-63
sp|C1EME8|Y3587_BACC3 UPF0061 protein BCA_3587 OS=Bacillus cereus (strain 03BB102) GN=BCA_3587 PE=3 SV=1 48 585 3.0E-63
sp|A9W9J2|Y4863_METEP UPF0061 protein Mext_4863 OS=Methylobacterium extorquens (strain PA1) GN=Mext_4863 PE=3 SV=1 49 587 3.0E-63
sp|Q6HFT0|Y3274_BACHK UPF0061 protein BT9727_3274 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_3274 PE=3 SV=1 48 585 4.0E-63
sp|Q0A9T9|Y1045_ALKEH UPF0061 protein Mlg_1045 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=Mlg_1045 PE=3 SV=1 19 586 5.0E-63
sp|B2VEL5|Y1831_ERWT9 UPF0061 protein ETA_18310 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ETA_18310 PE=3 SV=1 47 588 5.0E-63
sp|Q637V9|Y3222_BACCZ UPF0061 protein BCE33L3222 OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L3222 PE=3 SV=1 48 585 6.0E-63
sp|A0RGR8|Y3159_BACAH UPF0061 protein BALH_3159 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_3159 PE=3 SV=1 48 585 8.0E-63
sp|Q4KJF3|Y486_PSEF5 UPF0061 protein PFL_0486 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_0486 PE=3 SV=1 47 590 1.0E-62
sp|Q7WKJ9|Y2107_BORBR UPF0061 protein BB2107 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB2107 PE=3 SV=1 49 578 1.0E-62
sp|Q7W954|Y1919_BORPA UPF0061 protein BPP1919 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP1919 PE=3 SV=1 49 578 1.0E-62
sp|B7IQN3|Y1740_BACC2 UPF0061 protein BCG9842_B1740 OS=Bacillus cereus (strain G9842) GN=BCG9842_B1740 PE=3 SV=1 48 585 2.0E-62
sp|B2V536|Y1334_CLOBA UPF0061 protein CLH_1334 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=CLH_1334 PE=3 SV=1 49 588 2.0E-62
sp|P56914|NUOG2_RHIME NADH-quinone oxidoreductase subunit G 2 OS=Rhizobium meliloti (strain 1021) GN=nuoG2 PE=3 SV=2 628 1015 2.0E-62
sp|Q02EZ4|Y6641_PSEAB UPF0061 protein PA14_66410 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=PA14_66410 PE=3 SV=1 47 590 3.0E-62
sp|Q813A5|Y3499_BACCR UPF0061 protein BC_3499 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_3499 PE=3 SV=1 48 585 4.0E-62
sp|Q5L2V9|Y436_GEOKA UPF0061 protein GK0436 OS=Geobacillus kaustophilus (strain HTA426) GN=GK0436 PE=3 SV=1 49 588 5.0E-62
sp|Q89MQ0|Y4142_BRADU UPF0061 protein bll4142 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=bll4142 PE=3 SV=1 47 587 5.0E-62
sp|A7GQQ6|Y2214_BACCN UPF0061 protein Bcer98_2214 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_2214 PE=3 SV=1 47 588 6.0E-62
sp|Q8UGU0|Y945_AGRFC UPF0061 protein Atu0945 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu0945 PE=3 SV=1 104 587 6.0E-62
sp|Q9HUE6|Y5023_PSEAE UPF0061 protein PA5023 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA5023 PE=3 SV=1 48 590 9.0E-62
sp|Q21HQ5|Y2514_SACD2 UPF0061 protein Sde_2514 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=Sde_2514 PE=3 SV=1 51 595 1.0E-61
sp|C6C1K6|Y3130_DESAD UPF0061 protein Desal_3130 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=Desal_3130 PE=3 SV=1 104 587 1.0E-61
sp|Q3SU34|Y945_NITWN UPF0061 protein Nwi_0945 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_0945 PE=3 SV=1 20 587 2.0E-61
sp|A0KQK0|Y4127_AERHH UPF0061 protein AHA_4127 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=AHA_4127 PE=3 SV=1 53 588 2.0E-61
sp|B7V3B6|Y5413_PSEA8 UPF0061 protein PLES_54131 OS=Pseudomonas aeruginosa (strain LESB58) GN=PLES_54131 PE=3 SV=1 48 590 2.0E-61
sp|A1R9J0|Y3205_ARTAT UPF0061 protein AAur_3205 OS=Arthrobacter aurescens (strain TC1) GN=AAur_3205 PE=3 SV=1 54 590 2.0E-61
sp|Q1QJ74|Y2958_NITHX UPF0061 protein Nham_2958 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=Nham_2958 PE=3 SV=1 47 587 4.0E-61
sp|A9KM34|Y997_CLOPH UPF0061 protein Cphy_0997 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=Cphy_0997 PE=3 SV=1 47 586 4.0E-61
sp|B7H8P4|Y3508_BACC4 UPF0061 protein BCB4264_A3508 OS=Bacillus cereus (strain B4264) GN=BCB4264_A3508 PE=3 SV=1 48 585 5.0E-61
sp|A7MV92|Y1411_VIBCB UPF0061 protein VIBHAR_01411 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=VIBHAR_01411 PE=3 SV=1 108 587 5.0E-61
sp|Q3KJ68|Y444_PSEPF UPF0061 protein Pfl01_0444 OS=Pseudomonas fluorescens (strain Pf0-1) GN=Pfl01_0444 PE=3 SV=1 47 590 9.0E-61
sp|C1DHP3|Y4511_AZOVD UPF0061 protein Avin_45110 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=Avin_45110 PE=3 SV=1 47 597 1.0E-60
sp|Q1IG73|Y369_PSEE4 UPF0061 protein PSEEN0369 OS=Pseudomonas entomophila (strain L48) GN=PSEEN0369 PE=3 SV=1 47 590 1.0E-60
sp|Q2KYJ8|Y2277_BORA1 UPF0061 protein BAV2277 OS=Bordetella avium (strain 197N) GN=BAV2277 PE=3 SV=1 47 586 2.0E-60
sp|A7FT79|Y1226_CLOB1 UPF0061 protein CLB_1226 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=CLB_1226 PE=3 SV=1 47 588 6.0E-60
sp|A5I133|Y1195_CLOBH UPF0061 protein CBO1195/CLC_1238 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=CBO1195 PE=3 SV=1 47 588 6.0E-60
sp|Q6LQK3|Y2020_PHOPR UPF0061 protein PBPRA2020 OS=Photobacterium profundum GN=PBPRA2020 PE=3 SV=2 51 587 9.0E-60
sp|Q5WIY8|Y1129_BACSK UPF0061 protein ABC1129 OS=Bacillus clausii (strain KSM-K16) GN=ABC1129 PE=3 SV=1 49 601 1.0E-59
sp|C1FKS1|Y1348_CLOBJ UPF0061 protein CLM_1348 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=CLM_1348 PE=3 SV=1 47 588 1.0E-59
sp|Q56223|NQO3_THET8 NADH-quinone oxidoreductase subunit 3 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo3 PE=1 SV=2 628 1227 1.0E-59
sp|A4WTS8|Y1901_RHOS5 UPF0061 protein Rsph17025_1901 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=Rsph17025_1901 PE=3 SV=1 57 590 1.0E-59
sp|Q9KQR7|Y1931_VIBCH UPF0061 protein VC_1931 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1931 PE=3 SV=2 108 587 1.0E-59
sp|Q3JD89|Y691_NITOC UPF0061 protein Noc_0691 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=Noc_0691 PE=3 SV=2 49 587 2.0E-59
sp|A3PII0|Y1035_RHOS1 UPF0061 protein Rsph17029_1035 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=Rsph17029_1035 PE=3 SV=1 104 587 2.0E-59
sp|A6VDE4|Y5760_PSEA7 UPF0061 protein PSPA7_5760 OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_5760 PE=3 SV=1 47 590 3.0E-59
sp|B1KZF5|Y634_CLOBM UPF0061 protein CLK_0634 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=CLK_0634 PE=3 SV=1 47 588 7.0E-59
sp|Q3J3V1|Y965_RHOS4 UPF0061 protein RHOS4_09650 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=RHOS4_09650 PE=3 SV=1 104 587 8.0E-59
sp|A4VRA3|Y3881_PSEU5 UPF0061 protein PST_3881 OS=Pseudomonas stutzeri (strain A1501) GN=PST_3881 PE=3 SV=1 47 590 8.0E-59
sp|Q0VLS6|Y2424_ALCBS UPF0061 protein ABO_2424 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ABO_2424 PE=3 SV=1 47 587 9.0E-59
sp|Q0SJ74|Y577_RHOJR UPF0061 protein RHA1_ro00577 OS=Rhodococcus jostii (strain RHA1) GN=RHA1_ro00577 PE=3 SV=1 105 589 1.0E-58
sp|B7VL54|Y872_VIBTL UPF0061 protein VS_0872 OS=Vibrio tasmaniensis (strain LGP32) GN=VS_0872 PE=3 SV=1 49 596 2.0E-58
sp|P9WIV8|NUOG_MYCTO NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoG PE=3 SV=1 628 1025 3.0E-58
sp|P59962|NUOG_MYCBO NADH-quinone oxidoreductase subunit G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoG PE=3 SV=1 628 1025 3.0E-58
sp|A7GCN5|Y1279_CLOBL UPF0061 protein CLI_1279 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=CLI_1279 PE=3 SV=1 47 588 3.0E-58
sp|Q7VZ47|Y1090_BORPE UPF0061 protein BP1090 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=BP1090 PE=3 SV=1 49 578 3.0E-58
sp|Q6AIT0|Y3021_DESPS UPF0061 protein DP3021 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=DP3021 PE=3 SV=1 55 592 3.0E-58
sp|P9WIV9|NUOG_MYCTU NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoG PE=1 SV=1 628 1025 3.0E-58
sp|B5FG68|Y1896_VIBFM UPF0061 protein VFMJ11_1896 OS=Vibrio fischeri (strain MJ11) GN=VFMJ11_1896 PE=3 SV=1 108 597 4.0E-58
sp|Q0SWV5|Y040_CLOPS UPF0061 protein CPR_0040 OS=Clostridium perfringens (strain SM101 / Type A) GN=CPR_0040 PE=3 SV=1 47 588 5.0E-58
sp|B9KQ40|Y687_RHOSK UPF0061 protein RSKD131_0687 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=RSKD131_0687 PE=3 SV=1 104 587 6.0E-58
sp|A4XPR2|Y558_PSEMY UPF0061 protein Pmen_0558 OS=Pseudomonas mendocina (strain ymp) GN=Pmen_0558 PE=3 SV=1 47 566 6.0E-58
sp|Q3A7T7|Y297_PELCD UPF0061 protein Pcar_0297 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=Pcar_0297 PE=3 SV=1 47 587 6.0E-58
sp|B8H9H0|Y2066_ARTCA UPF0061 protein Achl_2066 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=Achl_2066 PE=3 SV=1 60 590 7.0E-58
sp|B1IJ78|Y3372_CLOBK UPF0061 protein CLD_3372 OS=Clostridium botulinum (strain Okra / Type B1) GN=CLD_3372 PE=3 SV=1 47 585 9.0E-58
sp|A4SHK8|Y185_AERS4 UPF0061 protein ASA_0185 OS=Aeromonas salmonicida (strain A449) GN=ASA_0185 PE=3 SV=1 53 588 1.0E-57
sp|Q5E3Y2|Y1769_VIBF1 UPF0061 protein VF_1769 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=VF_1769 PE=3 SV=1 108 597 5.0E-57
sp|C3KTA3|Y1236_CLOB6 UPF0061 protein CLJ_B1236 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=CLJ_B1236 PE=3 SV=1 47 588 5.0E-57
sp|Q0TV32|Y041_CLOP1 UPF0061 protein CPF_0041 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=CPF_0041 PE=3 SV=1 47 588 6.0E-57
sp|Q06373|Y035_CLOPE UPF0061 protein CPE0035 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0035 PE=3 SV=2 47 588 1.0E-56
sp|A6LWD4|Y2508_CLOB8 UPF0061 protein Cbei_2508 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=Cbei_2508 PE=3 SV=1 48 596 2.0E-56
sp|B6EIM5|Y2210_ALISL UPF0061 protein VSAL_I2210 OS=Aliivibrio salmonicida (strain LFI1238) GN=VSAL_I2210 PE=3 SV=1 108 567 3.0E-56
sp|Q73V62|Y3154_MYCPA UPF0061 protein MAP_3154 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_3154 PE=3 SV=1 82 590 3.0E-56
sp|A6VX63|Y2120_MARMS UPF0061 protein Mmwyl1_2120 OS=Marinomonas sp. (strain MWYL1) GN=Mmwyl1_2120 PE=3 SV=1 107 597 5.0E-56
sp|Q8EJX6|Y330_SHEON UPF0061 protein SO_0330 OS=Shewanella oneidensis (strain MR-1) GN=SO_0330 PE=3 SV=1 36 598 6.0E-56
sp|A0QV47|Y2445_MYCS2 UPF0061 protein MSMEG_2445/MSMEI_2384 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2445 PE=3 SV=1 56 590 7.0E-56
sp|A3Q9I6|Y262_SHELP UPF0061 protein Shew_0262 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=Shew_0262 PE=3 SV=1 49 605 8.0E-56
sp|Q5LQK9|Y2480_RUEPO UPF0061 protein SPO2480 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=SPO2480 PE=3 SV=2 49 587 1.0E-55
sp|Q28RE3|Y1802_JANSC UPF0061 protein Jann_1802 OS=Jannaschia sp. (strain CCS1) GN=Jann_1802 PE=3 SV=1 47 587 1.0E-55
sp|Q1GI57|Y926_RUEST UPF0061 protein TM1040_0926 OS=Ruegeria sp. (strain TM1040) GN=TM1040_0926 PE=3 SV=1 49 586 5.0E-55
sp|Q7NX94|Y1733_CHRVO UPF0061 protein CV_1733 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=CV_1733 PE=3 SV=1 53 587 1.0E-54
sp|Q0HE08|Y3645_SHESM UPF0061 protein Shewmr4_3645 OS=Shewanella sp. (strain MR-4) GN=Shewmr4_3645 PE=3 SV=1 36 598 4.0E-54
sp|Q0I001|Y299_SHESR UPF0061 protein Shewmr7_0299 OS=Shewanella sp. (strain MR-7) GN=Shewmr7_0299 PE=3 SV=1 103 598 5.0E-54
sp|A0L1Z0|Y3841_SHESA UPF0061 protein Shewana3_3841 OS=Shewanella sp. (strain ANA-3) GN=Shewana3_3841 PE=3 SV=1 36 598 7.0E-54
sp|Q7MMI2|Y1089_VIBVY UPF0061 protein VV1089 OS=Vibrio vulnificus (strain YJ016) GN=VV1089 PE=3 SV=1 108 587 1.0E-53
sp|A3D9W6|Y4063_SHEB5 UPF0061 protein Sbal_4063 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=Sbal_4063 PE=3 SV=1 36 598 4.0E-53
sp|A1UNS0|Y5290_MYCSK UPF0061 protein Mkms_5290 OS=Mycobacterium sp. (strain KMS) GN=Mkms_5290 PE=3 SV=1 54 590 6.0E-53
sp|Q1B1D0|Y5202_MYCSS UPF0061 protein Mmcs_5202 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_5202 PE=3 SV=1 54 590 6.0E-53
sp|B0TKD7|Y3983_SHEHH UPF0061 protein Shal_3983 OS=Shewanella halifaxensis (strain HAW-EB4) GN=Shal_3983 PE=3 SV=1 50 567 6.0E-53
sp|B8E8D7|Y3961_SHEB2 UPF0061 protein Sbal223_3961 OS=Shewanella baltica (strain OS223) GN=Sbal223_3961 PE=3 SV=1 36 598 7.0E-53
sp|Q164E9|Y3136_ROSDO UPF0061 protein RD1_3136 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=RD1_3136 PE=3 SV=1 49 449 7.0E-53
sp|A9L650|Y4156_SHEB9 UPF0061 protein Sbal195_4156 OS=Shewanella baltica (strain OS195) GN=Sbal195_4156 PE=3 SV=1 36 598 1.0E-52
sp|A3Q868|Y5582_MYCSJ UPF0061 protein Mjls_5582 OS=Mycobacterium sp. (strain JLS) GN=Mjls_5582 PE=3 SV=1 54 585 1.0E-52
sp|A6WTL7|Y4038_SHEB8 UPF0061 protein Shew185_4038 OS=Shewanella baltica (strain OS185) GN=Shew185_4038 PE=3 SV=1 36 598 2.0E-52
sp|Q3IJ32|Y182_PSEHT UPF0061 protein PSHAa0182 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=PSHAa0182 PE=3 SV=1 113 588 3.0E-52
sp|A4YBN4|Y3659_SHEPC UPF0061 protein Sputcn32_3659 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=Sputcn32_3659 PE=3 SV=1 36 587 4.0E-52
sp|A1RPL0|Y3800_SHESW UPF0061 protein Sputw3181_3800 OS=Shewanella sp. (strain W3-18-1) GN=Sputw3181_3800 PE=3 SV=1 36 587 6.0E-52
sp|Q8DG12|Y039_VIBVU UPF0061 protein VV1_0039 OS=Vibrio vulnificus (strain CMCP6) GN=VV1_0039 PE=3 SV=1 108 587 9.0E-52
sp|A8LHV2|Y1157_DINSH UPF0061 protein Dshi_1157 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=Dshi_1157 PE=3 SV=1 47 587 1.0E-51
sp|A8GZ99|Y308_SHEPA UPF0061 protein Spea_0308 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=Spea_0308 PE=3 SV=1 36 587 4.0E-51
sp|Q47WD4|Y4238_COLP3 UPF0061 protein CPS_4238 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=CPS_4238 PE=3 SV=1 86 587 4.0E-51
sp|Q088P6|Y407_SHEFN UPF0061 protein Sfri_0407 OS=Shewanella frigidimarina (strain NCIMB 400) GN=Sfri_0407 PE=3 SV=1 47 598 4.0E-51
sp|Q31E14|Y2019_THICR UPF0061 protein Tcr_2019 OS=Thiomicrospira crunogena (strain XCL-2) GN=Tcr_2019 PE=3 SV=1 49 590 5.0E-51
sp|Q2SAE6|Y5725_HAHCH UPF0061 protein HCH_05725 OS=Hahella chejuensis (strain KCTC 2396) GN=HCH_05725 PE=3 SV=1 49 586 7.0E-51
sp|Q12JH7|Y3122_SHEDO UPF0061 protein Sden_3122 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=Sden_3122 PE=3 SV=1 41 585 7.0E-51
sp|Q1GSU5|Y1564_SPHAL UPF0061 protein Sala_1564 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=Sala_1564 PE=3 SV=1 61 554 3.0E-50
sp|Q8FP92|Y1893_COREF UPF0061 protein CE1893 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE1893 PE=3 SV=1 54 585 4.0E-50
sp|C4L4K4|Y2651_EXISA UPF0061 protein EAT1b_2651 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=EAT1b_2651 PE=3 SV=1 45 567 5.0E-50
sp|Q4FMU2|Y678_PELUB UPF0061 protein SAR11_0678 OS=Pelagibacter ubique (strain HTCC1062) GN=SAR11_0678 PE=3 SV=1 61 585 2.0E-48
sp|Q74FU6|SFRA_GEOSL NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sfrA PE=1 SV=1 628 1025 1.0E-47
sp|D7AF63|SFRA_GEOSK NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain DL-1 / KN400) GN=sfrA PE=3 SV=1 628 1025 1.0E-47
sp|A4QF06|Y1828_CORGB UPF0061 protein cgR_1828 OS=Corynebacterium glutamicum (strain R) GN=cgR_1828 PE=3 SV=1 110 382 1.0E-46
sp|Q8NP26|Y1999_CORGL UPF0061 protein Cgl1999/cg2190 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl1999 PE=3 SV=1 110 382 1.0E-46
sp|C5BUK5|Y4165_TERTT UPF0061 protein TERTU_4165 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=TERTU_4165 PE=3 SV=1 47 587 1.0E-45
sp|Q89AU1|NUOG_BUCBP NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoG PE=3 SV=1 630 1000 2.0E-45
sp|Q9RA11|YU61_MORMI UPF0061 protein ORF18 OS=Moritella marina PE=3 SV=1 46 598 5.0E-45
sp|P57257|NUOG_BUCAI NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoG PE=3 SV=1 629 1000 6.0E-43
sp|P0A1Y4|NUOG_SALTY NADH-quinone oxidoreductase subunit G OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoG PE=3 SV=2 630 1000 3.0E-42
sp|P0A1Y5|NUOG_SALTI NADH-quinone oxidoreductase subunit G OS=Salmonella typhi GN=nuoG PE=3 SV=2 630 1000 3.0E-42
sp|B2J918|Y5734_NOSP7 UPF0061 protein Npun_F5734 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_F5734 PE=3 SV=1 113 567 3.0E-42
sp|Q8FFJ9|NUOG_ECOL6 NADH-quinone oxidoreductase subunit G OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoG PE=3 SV=3 630 1000 5.0E-42
sp|Q7UC56|NUOG_SHIFL NADH-quinone oxidoreductase subunit G OS=Shigella flexneri GN=nuoG PE=3 SV=3 630 1000 7.0E-42
sp|P33602|NUOG_ECOLI NADH-quinone oxidoreductase subunit G OS=Escherichia coli (strain K12) GN=nuoG PE=1 SV=4 630 1000 7.0E-42
sp|Q8XCX2|NUOG_ECO57 NADH-quinone oxidoreductase subunit G OS=Escherichia coli O157:H7 GN=nuoG PE=3 SV=3 630 1000 8.0E-42
sp|Q8K9Y2|NUOG_BUCAP NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoG PE=3 SV=1 629 1016 2.0E-41
sp|Q9KGW3|NUOG_PSEFL NADH-quinone oxidoreductase subunit G OS=Pseudomonas fluorescens GN=nuoG PE=2 SV=1 630 885 2.0E-41
sp|Q88FH2|NUOG_PSEPK NADH-quinone oxidoreductase subunit G OS=Pseudomonas putida (strain KT2440) GN=nuoG PE=3 SV=1 630 885 3.0E-40
sp|Q8EI34|NUOG_SHEON NADH-quinone oxidoreductase subunit G OS=Shewanella oneidensis (strain MR-1) GN=nuoG PE=3 SV=1 630 885 4.0E-40
sp|Q87ZQ4|NUOG_PSESM NADH-quinone oxidoreductase subunit G OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoG PE=3 SV=1 630 900 5.0E-40
sp|Q9I0J6|NUOG_PSEAE NADH-quinone oxidoreductase subunit G OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoG PE=3 SV=1 630 885 1.0E-39
sp|Q7NN18|Y596_GLOVI UPF0061 protein gll0596 OS=Gloeobacter violaceus (strain PCC 7421) GN=gll0596 PE=3 SV=1 27 492 1.0E-39
sp|Q8ZDL2|NUOG_YERPE NADH-quinone oxidoreductase subunit G OS=Yersinia pestis GN=nuoG PE=3 SV=1 630 885 1.0E-39
sp|Q5N636|Y041_SYNP6 UPF0061 protein syc0041_c OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=syc0041_c PE=3 SV=1 102 470 2.0E-38
sp|Q8KPU0|Y1584_SYNE7 UPF0061 protein Synpcc7942_1584 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1584 PE=3 SV=2 102 470 4.0E-38
sp|Q115Q9|Y1476_TRIEI UPF0061 protein Tery_1476 OS=Trichodesmium erythraeum (strain IMS101) GN=Tery_1476 PE=3 SV=1 113 491 7.0E-38
sp|Q8YT50|Y2876_NOSS1 UPF0061 protein all2876 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2876 PE=3 SV=1 113 471 9.0E-38
sp|Q7VRV7|NUOG_BLOFL NADH-quinone oxidoreductase subunit G OS=Blochmannia floridanus GN=nuoG PE=3 SV=1 628 1098 1.0E-37
sp|Q8DIF6|Y1633_THEEB UPF0061 protein tll1633 OS=Thermosynechococcus elongatus (strain BP-1) GN=tll1633 PE=3 SV=1 102 369 2.0E-36
sp|P73436|YZ64_SYNY3 UPF0061 protein sll1464 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1464 PE=3 SV=1 113 494 2.0E-36
sp|Q3MED4|Y1028_ANAVT UPF0061 protein Ava_1028 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_1028 PE=3 SV=1 113 471 2.0E-36
sp|Q46508|HNDD_DESFR NADP-reducing hydrogenase subunit HndC OS=Desulfovibrio fructosivorans GN=hndD PE=1 SV=1 628 838 1.0E-28
sp|Q49ZN0|FDHL_STAS1 Putative formate dehydrogenase SSP0601 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0601 PE=3 SV=1 630 1016 7.0E-23
sp|Q6GEC4|FDHL_STAAR Putative formate dehydrogenase SAR2393 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2393 PE=3 SV=1 630 1016 9.0E-19
sp|Q931G2|FDHL_STAAM Putative formate dehydrogenase SAV2309 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2309 PE=3 SV=1 630 1016 2.0E-18
sp|Q7A057|FDHL_STAAW Putative formate dehydrogenase MW2229 OS=Staphylococcus aureus (strain MW2) GN=MW2229 PE=3 SV=1 630 1016 2.0E-18
sp|Q6G711|FDHL_STAAS Putative formate dehydrogenase SAS2201 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2201 PE=3 SV=1 630 1016 2.0E-18
sp|Q99RW4|FDHL_STAAN Putative formate dehydrogenase SA2102 OS=Staphylococcus aureus (strain N315) GN=SA2102 PE=1 SV=1 630 1016 2.0E-18
sp|Q5HDP9|FDHL_STAAC Putative formate dehydrogenase SACOL2301 OS=Staphylococcus aureus (strain COL) GN=SACOL2301 PE=3 SV=1 630 1016 3.0E-18
sp|Q2FVV9|FDHL_STAA8 Putative formate dehydrogenase SAOUHSC_02582 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02582 PE=3 SV=1 630 1016 3.0E-18
sp|Q2FEI5|FDHL_STAA3 Putative formate dehydrogenase SAUSA300_2258 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2258 PE=3 SV=1 630 1016 3.0E-18
sp|Q2YYT1|FDHL_STAAB Putative formate dehydrogenase SAB2186c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2186c PE=3 SV=1 630 1016 3.0E-18
sp|Q795Y4|FDHL_BACSU Putative formate dehydrogenase YrhE OS=Bacillus subtilis (strain 168) GN=yrhE PE=3 SV=1 628 1016 2.0E-17
sp|P22318|HOXU_CUPNH NAD-reducing hydrogenase HoxS subunit gamma OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hoxU PE=1 SV=2 628 831 3.0E-17
sp|Q4L8G8|FDHL_STAHJ Putative formate dehydrogenase SH0748 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0748 PE=3 SV=1 630 1016 8.0E-17
sp|O34720|YJGC_BACSU Probable oxidoreductase YjgC OS=Bacillus subtilis (strain 168) GN=yjgC PE=3 SV=1 630 1016 2.0E-16
sp|Q60314|Y006_METJA Uncharacterized oxidoreductase MJ0006 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0006 PE=3 SV=1 893 1234 9.0E-11
sp|P61159|FDHA_METJA Formate dehydrogenase subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fdhA PE=3 SV=2 1136 1242 2.0E-09
sp|Q795Y4|FDHL_BACSU Putative formate dehydrogenase YrhE OS=Bacillus subtilis (strain 168) GN=yrhE PE=3 SV=1 1129 1251 4.0E-07
sp|Q49ZN0|FDHL_STAS1 Putative formate dehydrogenase SSP0601 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0601 PE=3 SV=1 1138 1242 5.0E-07
sp|Q2YYT1|FDHL_STAAB Putative formate dehydrogenase SAB2186c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2186c PE=3 SV=1 1156 1242 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0016651 oxidoreductase activity, acting on NAD(P)H Yes
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0051540 metal cluster binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3119
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|314
Ophiocordyceps australis map64 (Brazil) OphauB2|3315
Ophiocordyceps camponoti-floridani Ophcf2|06710
Ophiocordyceps camponoti-rufipedis Ophun1|5532 (this protein)
Ophiocordyceps kimflemingae Ophio5|2832
Ophiocordyceps subramaniannii Hirsu2|5467

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5532
MHGATLKDLPKTWRFTESLPADSQFPTPASSHKTPRQDIRPRGPVRDALFTWVRPEPQLDPELLAVSPAALHTLG
IRADEAGSDDFRHFVAGNRLYGWDESRLQGGYPWAQCYGGFQFGQWAGQLGDGRAISLFETTNHEGHRYELQLKG
AGMTPYSRFADGKAVLRSSIREFIVSEALDALGIPSTRALSLTLLPHSRVARETMEPAAIVLRFARSWLRLGSFD
ILRARGDRQLTRKLAAYVADEVLGGWHALPARLADPGKPAESPPPSRHVAPETLQGPDYAIENRFTRLYREVVRR
NAATVAAWQVYGFMNGVLNTDNTSICGLSIDFGPFAFMDNFDPSYTPNHDDHMLRYSYRNQPTIIWWNLVRFGEA
LGELMGAGAAVDDASFIADGVGEGREKELVARAEKLIAQAGDEYQAVFLAEFKRLMAARLGLRHCKESDFGELFG
SALDTMEALELDYNHFFRRLSDVKLAQVDSSESRRKTASVFFHNEGAPKAVGEQEAREQLATWLDKWQRRVREDW
DMGDGAIPDDKDEERMGAMKRVNPNFIPRGWILDEVIRRVEKEGERDVLNRVMHMALHPFEDSWGGHEDEEKRRD
AMLRRSVVRSAANCTRTFATTPRRRAEVELTIDGKKVSIEAGSALIQACEKAGVTVPRKLMIAGNCRMCLVEVER
APKPVASCAWPVQPGMVVKTNSPLTHKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMRYGADRGRFHEMGGK
RAVEDKNIGPLIKTSMNRCIHCTRCVRFANDVAGAPELGSTGRGNDLQIGTYLEQNLDSELSANVIDLCPVGALT
SKPYAFRARPWELKHTESVDVLDGLGSNIRIDSRGLEVMRILPRLNDDVNEEWINDKTRFACDGLKTQRLTMPLV
RREGRLEPAEWEEALCEVARAWGQKKPQGNEFKVIAGALTDVESLVLAKELANKLGSENLALDTPGGGRPLAHGV
DVRSNYLFNSTIWGIEEADCILIVGCNPRLEAAVLNARIRKQWLRSDLEIGVVGQTWDSTFEFEHLGVDLAALKK
ALAGPFGKKLQEAKRPMMIVGSGVTDHVDARAFYETMGAFVHKNAAKFTTDEWNGFNVLQREASRAGAFEVGFVT
PSAAVAETKPKFLWLLGADELGAADIPKDAFVVYQGHHGDRGAQLADVILPGAAYTEKTSTYVNTEGRAQTTRAA
TSLPGASRADWKILRAASEFLGAPLPYDDVEAVRDRMAEISPALLAYGVVEPVALQQLSKVQLVDQNKGAKVAGS
PLENVIENFYFTDVISRRQLTDHGSLLGSQGGEGSEDELYGSGHGGGQADGSGRSRAHRPTSRARRPLSVSEAAT
*
Coding >Ophun1|5532
ATGCACGGCGCGACGCTCAAGGACCTGCCCAAGACGTGGCGCTTCACCGAGAGCCTCCCCGCCGACAGCCAGTTC
CCGACACCGGCGTCGTCGCACAAGACGCCCCGGCAAGACATCCGGCCACGCGGGCCCGTCCGCGACGCCCTCTTC
ACCTGGGTGCGGCCCGAACCTCAGCTCGATCCGGAGCTCCTGGCCGTCAGCCCCGCGGCGCTGCACACGCTGGGC
ATCAGGGCGGATGAGGCTGGCTCCGACGACTTCCGTCACTTCGTCGCTGGGAACCGGCTATATGGATGGGATGAG
TCTCGCTTGCAGGGCGGTTACCCCTGGGCTCAGTGCTACGGAGGCTTCCAGTTCGGTCAGTGGGCCGGTCAGCTC
GGCGACGGGAGGGCCATTTCGCTATTCGAGACGACGAATCATGAGGGTCATCGTTACGAGTTGCAGCTCAAGGGC
GCGGGCATGACGCCCTACTCGCGCTTCGCCGATGGAAAGGCCGTTTTGCGATCGAGTATCCGCGAGTTCATCGTT
TCCGAGGCCCTCGACGCGCTGGGAATCCCCTCGACGCGCGCCCTTTCGCTGACGTTGCTGCCGCACTCGCGCGTT
GCCCGCGAGACCATGGAGCCGGCCGCCATCGTCCTGCGCTTCGCTCGCTCGTGGCTTCGCCTCGGGAGCTTCGAC
ATCTTGCGCGCTCGCGGTGATAGGCAGCTGACTCGCAAGCTGGCTGCCTACGTCGCGGATGAGGTTCTCGGTGGC
TGGCACGCTCTGCCTGCGCGTCTGGCGGATCCGGGAAAGCCGGCCGAGTCGCCGCCTCCGTCGCGTCATGTCGCG
CCCGAGACGCTACAAGGTCCCGACTACGCCATCGAGAACCGCTTCACCAGGCTGTACAGGGAGGTTGTGCGGAGG
AACGCGGCGACCGTGGCCGCTTGGCAGGTTTACGGCTTCATGAATGGCGTCTTGAATACTGACAACACGTCCATC
TGCGGTCTCTCCATCGACTTCGGCCCCTTTGCCTTCATGGACAACTTCGACCCCTCCTACACGCCCAACCACGAC
GATCACATGCTGCGCTACAGCTACAGGAACCAGCCGACCATCATCTGGTGGAACCTCGTACGCTTCGGAGAGGCG
CTGGGCGAGCTCATGGGCGCCGGCGCCGCTGTCGACGACGCGTCCTTCATCGCAGACGGCGTCGGCGAGGGACGG
GAGAAGGAGCTGGTGGCCCGAGCCGAGAAGCTCATCGCCCAGGCCGGCGACGAGTACCAAGCCGTCTTCTTGGCC
GAGTTCAAGCGGCTGATGGCGGCGCGTCTGGGGCTTCGGCACTGCAAAGAGTCCGACTTTGGCGAGCTGTTCGGC
TCAGCCCTCGACACCATGGAGGCTCTCGAGCTGGATTACAACCACTTCTTCCGCCGGCTGAGCGACGTCAAACTG
GCCCAAGTCGATTCGTCCGAAAGCAGGAGAAAAACAGCTTCCGTCTTCTTCCACAACGAAGGCGCGCCCAAGGCC
GTCGGCGAGCAAGAGGCTCGGGAGCAGCTGGCCACCTGGCTCGACAAGTGGCAGAGACGGGTGAGGGAGGATTGG
GACATGGGCGACGGCGCCATTCCGGACGACAAGGACGAGGAGAGGATGGGCGCCATGAAGCGCGTCAACCCGAAC
TTCATCCCACGCGGTTGGATATTGGACGAAGTCATCCGACGCGTGGAAAAGGAGGGCGAGCGAGACGTCTTGAAC
CGCGTCATGCACATGGCACTCCACCCCTTTGAAGATTCGTGGGGCGGCCACGAGGACGAGGAGAAGAGACGAGAC
GCCATGCTTCGACGCTCTGTGGTCCGCTCAGCGGCCAATTGCACCCGGACCTTTGCGACGACGCCACGGCGACGG
GCCGAGGTTGAGCTGACGATTGACGGAAAGAAGGTGTCTATCGAAGCGGGCTCTGCCCTGATCCAAGCCTGCGAA
AAGGCTGGCGTCACGGTTCCCCGAAAACTCATGATCGCCGGCAACTGCCGAATGTGCTTGGTCGAGGTCGAGCGG
GCGCCCAAACCAGTCGCCTCGTGTGCTTGGCCTGTCCAGCCCGGCATGGTGGTCAAGACCAACTCACCCCTCACA
CACAAGGCTCGCGAGGGAGTCATGGAATTCCTCCTCGCCAACCACCCCCTCGACTGTCCCATCTGCGATCAGGGC
GGCGAGTGCGATCTACAGGATCAGTCGATGCGCTACGGCGCTGACCGAGGACGATTTCACGAGATGGGCGGCAAG
CGAGCCGTCGAGGACAAGAACATCGGTCCGCTGATCAAGACGTCGATGAACCGGTGCATTCACTGCACCCGATGC
GTGCGTTTCGCCAACGACGTCGCCGGTGCTCCGGAGCTGGGTTCTACCGGGCGTGGCAACGATCTGCAGATCGGC
ACCTACCTCGAGCAGAACCTCGACTCGGAGCTCTCCGCCAACGTCATCGATCTCTGCCCCGTCGGTGCGCTGACG
TCGAAGCCGTATGCGTTCCGGGCCCGACCCTGGGAGCTCAAGCACACCGAGTCCGTCGACGTTCTCGACGGCTTG
GGATCCAACATTCGCATCGACTCCAGAGGTCTCGAGGTGATGCGCATTCTGCCCCGCCTCAACGACGACGTCAAC
GAGGAATGGATCAACGACAAGACACGATTCGCCTGCGATGGCCTCAAGACGCAGCGTCTGACGATGCCGCTGGTC
CGACGCGAGGGCAGACTCGAGCCCGCAGAGTGGGAAGAGGCCCTCTGCGAGGTGGCCAGAGCGTGGGGACAGAAG
AAGCCTCAGGGCAACGAGTTCAAGGTGATTGCTGGTGCCCTGACCGACGTCGAATCCCTGGTCCTGGCCAAGGAG
CTCGCCAATAAGCTGGGGTCCGAGAATCTGGCCTTGGACACTCCCGGTGGAGGCCGCCCGCTGGCACACGGCGTC
GACGTGCGGTCGAATTACCTCTTCAACTCGACCATCTGGGGCATCGAAGAGGCGGACTGCATCCTCATCGTCGGA
TGCAACCCGCGCCTCGAGGCGGCGGTTCTGAATGCTCGCATCCGGAAGCAGTGGCTACGTTCCGACCTCGAGATC
GGCGTAGTCGGCCAGACCTGGGACTCGACCTTTGAGTTTGAGCACTTGGGCGTCGATCTCGCTGCCCTCAAGAAG
GCGCTGGCCGGTCCCTTTGGCAAGAAGCTCCAGGAGGCGAAGAGGCCGATGATGATTGTCGGTTCCGGCGTCACC
GACCACGTTGATGCCAGGGCCTTTTACGAGACGATGGGTGCATTCGTACACAAGAACGCGGCAAAGTTCACGACG
GACGAGTGGAACGGCTTCAACGTGCTGCAGAGGGAAGCCTCGAGGGCGGGCGCCTTCGAGGTCGGTTTCGTGACG
CCGTCGGCTGCCGTTGCCGAGACGAAGCCCAAGTTCCTGTGGCTGCTGGGCGCAGACGAGCTGGGAGCGGCCGAC
ATCCCCAAGGATGCCTTTGTCGTCTATCAGGGTCATCACGGCGACCGTGGCGCGCAGCTCGCAGACGTCATCCTA
CCCGGTGCCGCTTACACGGAGAAGACGAGCACGTACGTCAACACCGAGGGGCGGGCGCAGACGACGCGCGCGGCC
ACGTCACTGCCCGGTGCGTCACGAGCCGACTGGAAGATCCTGCGGGCGGCCAGCGAGTTTCTCGGCGCGCCGCTG
CCCTACGATGACGTCGAGGCCGTGAGGGATCGCATGGCCGAGATCAGCCCGGCCCTGTTGGCCTACGGCGTCGTC
GAGCCCGTGGCGTTGCAGCAGCTGAGCAAGGTGCAGCTGGTGGACCAGAACAAGGGCGCCAAGGTGGCCGGATCG
CCGCTGGAGAATGTCATTGAAAACTTTTACTTTACAGACGTCATCTCTCGGAGGCAACTCACCGACCATGGCTCG
CTGCTCGGCAGCCAAGGCGGCGAGGGATCCGAGGACGAACTTTATGGCTCCGGGCATGGAGGAGGACAAGCCGAT
GGGTCAGGTAGATCTCGAGCTCATCGTCCGACCTCAAGGGCCAGAAGGCCGTTGAGCGTTTCCGAAGCCGCGACG
TGA
Transcript >Ophun1|5532
ATGCACGGCGCGACGCTCAAGGACCTGCCCAAGACGTGGCGCTTCACCGAGAGCCTCCCCGCCGACAGCCAGTTC
CCGACACCGGCGTCGTCGCACAAGACGCCCCGGCAAGACATCCGGCCACGCGGGCCCGTCCGCGACGCCCTCTTC
ACCTGGGTGCGGCCCGAACCTCAGCTCGATCCGGAGCTCCTGGCCGTCAGCCCCGCGGCGCTGCACACGCTGGGC
ATCAGGGCGGATGAGGCTGGCTCCGACGACTTCCGTCACTTCGTCGCTGGGAACCGGCTATATGGATGGGATGAG
TCTCGCTTGCAGGGCGGTTACCCCTGGGCTCAGTGCTACGGAGGCTTCCAGTTCGGTCAGTGGGCCGGTCAGCTC
GGCGACGGGAGGGCCATTTCGCTATTCGAGACGACGAATCATGAGGGTCATCGTTACGAGTTGCAGCTCAAGGGC
GCGGGCATGACGCCCTACTCGCGCTTCGCCGATGGAAAGGCCGTTTTGCGATCGAGTATCCGCGAGTTCATCGTT
TCCGAGGCCCTCGACGCGCTGGGAATCCCCTCGACGCGCGCCCTTTCGCTGACGTTGCTGCCGCACTCGCGCGTT
GCCCGCGAGACCATGGAGCCGGCCGCCATCGTCCTGCGCTTCGCTCGCTCGTGGCTTCGCCTCGGGAGCTTCGAC
ATCTTGCGCGCTCGCGGTGATAGGCAGCTGACTCGCAAGCTGGCTGCCTACGTCGCGGATGAGGTTCTCGGTGGC
TGGCACGCTCTGCCTGCGCGTCTGGCGGATCCGGGAAAGCCGGCCGAGTCGCCGCCTCCGTCGCGTCATGTCGCG
CCCGAGACGCTACAAGGTCCCGACTACGCCATCGAGAACCGCTTCACCAGGCTGTACAGGGAGGTTGTGCGGAGG
AACGCGGCGACCGTGGCCGCTTGGCAGGTTTACGGCTTCATGAATGGCGTCTTGAATACTGACAACACGTCCATC
TGCGGTCTCTCCATCGACTTCGGCCCCTTTGCCTTCATGGACAACTTCGACCCCTCCTACACGCCCAACCACGAC
GATCACATGCTGCGCTACAGCTACAGGAACCAGCCGACCATCATCTGGTGGAACCTCGTACGCTTCGGAGAGGCG
CTGGGCGAGCTCATGGGCGCCGGCGCCGCTGTCGACGACGCGTCCTTCATCGCAGACGGCGTCGGCGAGGGACGG
GAGAAGGAGCTGGTGGCCCGAGCCGAGAAGCTCATCGCCCAGGCCGGCGACGAGTACCAAGCCGTCTTCTTGGCC
GAGTTCAAGCGGCTGATGGCGGCGCGTCTGGGGCTTCGGCACTGCAAAGAGTCCGACTTTGGCGAGCTGTTCGGC
TCAGCCCTCGACACCATGGAGGCTCTCGAGCTGGATTACAACCACTTCTTCCGCCGGCTGAGCGACGTCAAACTG
GCCCAAGTCGATTCGTCCGAAAGCAGGAGAAAAACAGCTTCCGTCTTCTTCCACAACGAAGGCGCGCCCAAGGCC
GTCGGCGAGCAAGAGGCTCGGGAGCAGCTGGCCACCTGGCTCGACAAGTGGCAGAGACGGGTGAGGGAGGATTGG
GACATGGGCGACGGCGCCATTCCGGACGACAAGGACGAGGAGAGGATGGGCGCCATGAAGCGCGTCAACCCGAAC
TTCATCCCACGCGGTTGGATATTGGACGAAGTCATCCGACGCGTGGAAAAGGAGGGCGAGCGAGACGTCTTGAAC
CGCGTCATGCACATGGCACTCCACCCCTTTGAAGATTCGTGGGGCGGCCACGAGGACGAGGAGAAGAGACGAGAC
GCCATGCTTCGACGCTCTGTGGTCCGCTCAGCGGCCAATTGCACCCGGACCTTTGCGACGACGCCACGGCGACGG
GCCGAGGTTGAGCTGACGATTGACGGAAAGAAGGTGTCTATCGAAGCGGGCTCTGCCCTGATCCAAGCCTGCGAA
AAGGCTGGCGTCACGGTTCCCCGAAAACTCATGATCGCCGGCAACTGCCGAATGTGCTTGGTCGAGGTCGAGCGG
GCGCCCAAACCAGTCGCCTCGTGTGCTTGGCCTGTCCAGCCCGGCATGGTGGTCAAGACCAACTCACCCCTCACA
CACAAGGCTCGCGAGGGAGTCATGGAATTCCTCCTCGCCAACCACCCCCTCGACTGTCCCATCTGCGATCAGGGC
GGCGAGTGCGATCTACAGGATCAGTCGATGCGCTACGGCGCTGACCGAGGACGATTTCACGAGATGGGCGGCAAG
CGAGCCGTCGAGGACAAGAACATCGGTCCGCTGATCAAGACGTCGATGAACCGGTGCATTCACTGCACCCGATGC
GTGCGTTTCGCCAACGACGTCGCCGGTGCTCCGGAGCTGGGTTCTACCGGGCGTGGCAACGATCTGCAGATCGGC
ACCTACCTCGAGCAGAACCTCGACTCGGAGCTCTCCGCCAACGTCATCGATCTCTGCCCCGTCGGTGCGCTGACG
TCGAAGCCGTATGCGTTCCGGGCCCGACCCTGGGAGCTCAAGCACACCGAGTCCGTCGACGTTCTCGACGGCTTG
GGATCCAACATTCGCATCGACTCCAGAGGTCTCGAGGTGATGCGCATTCTGCCCCGCCTCAACGACGACGTCAAC
GAGGAATGGATCAACGACAAGACACGATTCGCCTGCGATGGCCTCAAGACGCAGCGTCTGACGATGCCGCTGGTC
CGACGCGAGGGCAGACTCGAGCCCGCAGAGTGGGAAGAGGCCCTCTGCGAGGTGGCCAGAGCGTGGGGACAGAAG
AAGCCTCAGGGCAACGAGTTCAAGGTGATTGCTGGTGCCCTGACCGACGTCGAATCCCTGGTCCTGGCCAAGGAG
CTCGCCAATAAGCTGGGGTCCGAGAATCTGGCCTTGGACACTCCCGGTGGAGGCCGCCCGCTGGCACACGGCGTC
GACGTGCGGTCGAATTACCTCTTCAACTCGACCATCTGGGGCATCGAAGAGGCGGACTGCATCCTCATCGTCGGA
TGCAACCCGCGCCTCGAGGCGGCGGTTCTGAATGCTCGCATCCGGAAGCAGTGGCTACGTTCCGACCTCGAGATC
GGCGTAGTCGGCCAGACCTGGGACTCGACCTTTGAGTTTGAGCACTTGGGCGTCGATCTCGCTGCCCTCAAGAAG
GCGCTGGCCGGTCCCTTTGGCAAGAAGCTCCAGGAGGCGAAGAGGCCGATGATGATTGTCGGTTCCGGCGTCACC
GACCACGTTGATGCCAGGGCCTTTTACGAGACGATGGGTGCATTCGTACACAAGAACGCGGCAAAGTTCACGACG
GACGAGTGGAACGGCTTCAACGTGCTGCAGAGGGAAGCCTCGAGGGCGGGCGCCTTCGAGGTCGGTTTCGTGACG
CCGTCGGCTGCCGTTGCCGAGACGAAGCCCAAGTTCCTGTGGCTGCTGGGCGCAGACGAGCTGGGAGCGGCCGAC
ATCCCCAAGGATGCCTTTGTCGTCTATCAGGGTCATCACGGCGACCGTGGCGCGCAGCTCGCAGACGTCATCCTA
CCCGGTGCCGCTTACACGGAGAAGACGAGCACGTACGTCAACACCGAGGGGCGGGCGCAGACGACGCGCGCGGCC
ACGTCACTGCCCGGTGCGTCACGAGCCGACTGGAAGATCCTGCGGGCGGCCAGCGAGTTTCTCGGCGCGCCGCTG
CCCTACGATGACGTCGAGGCCGTGAGGGATCGCATGGCCGAGATCAGCCCGGCCCTGTTGGCCTACGGCGTCGTC
GAGCCCGTGGCGTTGCAGCAGCTGAGCAAGGTGCAGCTGGTGGACCAGAACAAGGGCGCCAAGGTGGCCGGATCG
CCGCTGGAGAATGTCATTGAAAACTTTTACTTTACAGACGTCATCTCTCGGAGGCAACTCACCGACCATGGCTCG
CTGCTCGGCAGCCAAGGCGGCGAGGGATCCGAGGACGAACTTTATGGCTCCGGGCATGGAGGAGGACAAGCCGAT
GGGTCAGGTAGATCTCGAGCTCATCGTCCGACCTCAAGGGCCAGAAGGCCGTTGAGCGTTTCCGAAGCCGCGACG
TGA
Gene >Ophun1|5532
ATGCACGGCGCGACGCTCAAGGACCTGCCCAAGACGTGGCGCTTCACCGAGAGCCTCCCCGCCGACAGCCAGTTC
CCGACACCGGCGTCGTCGCACAAGACGCCCCGGCAAGACATCCGGCCACGCGGGCCCGTCCGCGACGCCCTCTTC
ACCTGGGTGCGGCCCGAACCTCAGCTCGATCCGGAGCTCCTGGCCGTCAGCCCCGCGGCGCTGCACACGCTGGGC
ATCAGGGCGGATGAGGCTGGCTCCGACGACTTCCGTCACTTCGTCGCTGGGAACCGGCTATATGGATGGGATGAG
TCTCGCTTGCAGGGCGGTTACCCCTGGGCTCAGTGCTACGGAGGCTTCCAGTTCGGTCAGTGGGCCGGTCAGCTC
GGCGACGGGAGGGCCATTTCGCTATTCGAGACGACGAATCATGAGGGTCATCGTTACGAGTTGCAGCTCAAGGGC
GCGGGCATGACGCCCTACTCGCGCTTCGCCGATGGAAAGGCCGTTTTGCGATCGAGTATCCGCGAGTTCATCGTT
TCCGAGGCCCTCGACGCGCTGGGAATCCCCTCGACGCGCGCCCTTTCGCTGACGTTGCTGCCGCACTCGCGCGTT
GCCCGCGAGACCATGGAGCCGGCCGCCATCGTCCTGCGCTTCGCTCGCTCGTGGCTTCGCCTCGGGAGCTTCGAC
ATCTTGCGCGCTCGCGGTGATAGGCAGCTGACTCGCAAGCTGGCTGCCTACGTCGCGGATGAGGTTCTCGGTGGC
TGGCACGCTCTGCCTGCGCGTCTGGCGGATCCGGGAAAGCCGGCCGAGTCGCCGCCTCCGTCGCGTCATGTCGCG
CCCGAGACGCTACAAGGTCCCGACTACGCCATCGAGAACCGCTTCACCAGGCTGTACAGGGAGGTTGTGCGGAGG
AACGCGGCGACCGTGGCCGCTTGGCAGGTTTACGGCTTCATGAATGGCGTCTTGGTGAGCGTCATCGACATGGAG
CTGTATGATGGAGATTGCGTCGCTGACCGTTACAATAGAATACTGACAACACGTCCATCTGCGGTCTCTCCATCG
ACTTCGGCCCCTTTGCCTTCATGGACAACTTCGACCCCTCCTACACGCCCAACCACGACGATCACATGCTGCGCT
ACAGCTACAGGAACCAGCCGACCATCATCTGGTGGAACCTCGTACGCTTCGGAGAGGCGCTGGGCGAGCTCATGG
GCGCCGGCGCCGCTGTCGACGACGCGTCCTTCATCGCAGACGGCGTCGGCGAGGGACGGGAGAAGGAGCTGGTGG
CCCGAGCCGAGAAGCTCATCGCCCAGGCCGGCGACGAGTACCAAGCCGTCTTCTTGGCCGAGTTCAAGCGGCTGA
TGGCGGCGCGTCTGGGGCTTCGGCACTGCAAAGAGTCCGACTTTGGCGAGCTGTTCGGCTCAGCCCTCGACACCA
TGGAGGCTCTCGAGCTGGATTACAACCACTTCTTCCGCCGGCTGAGCGACGTCAAACTGGCCCAAGTCGATTCGT
CCGAAAGCAGGAGAAAAACAGCTTCCGTCTTCTTCCACAACGAAGGCGCGCCCAAGGCCGTCGGCGAGCAAGAGG
CTCGGGAGCAGCTGGCCACCTGGCTCGACAAGTGGCAGAGACGGGTGAGGGAGGATTGGGACATGGGCGACGGCG
CCATTCCGGACGACAAGGACGAGGAGAGGATGGGCGCCATGAAGCGCGTCAACCCGAACTTCATCCCACGCGGTT
GGATATTGGACGAAGTCATCCGACGCGTGGAAAAGGAGGGCGAGCGAGACGTCTTGAACCGCGTCATGCACATGG
CACTCCACCCCTTTGAAGATTCGTGGGGCGGCCACGAGGACGAGGAGAAGAGGTGGGTGGGCGACGTGCCGCGGA
CAGAGCGGGCTATGCAGTGCAGTTGTAGCTCATAGTCATTGACGGTTGGTGTGTACTCGATTATATGTGACGACC
GGCGGTAAGAGGCATCGCTCACGGAGGCGGACAGCCTCTTCGCGCGCTTCCTTTAACGGCGTAGGCTTTTGCTCT
GGAGCACATGATAGAGGAAGACTCGATGGAGACGGCGCGAAGCCGTGCAAAGCTCACCTACAATAAAAGTGCTCG
TAGTACAATGATGAGAGAAGAAGAAGAGAGGGGGAGTGAGGCTCGGGGGAAATTTTCACCAAATATCCGGCCAGC
GGGTCCTGCTCCGCTGTGGCCTCAGGCAGACACGAGCGGGTGTGCGAACAAAGAAGAGTATGTACGAATACGAAT
ACGAATATATCACCCACTAACCCTCTGGCCAATCAGCGTCTCTGCGAATTAATCCGTTGCGCCACCTCCAAAGCT
CCCCATCAACCATCCCCGTCACTCTCGTCGCCCCTCAGCTGCTACCGGTTCCAGACGAGACGCCATGCTTCGACG
CTCTGTGGTCCGCTCAGCGGCCAATTGCACCCGGACCTTTGCGACGACGCCACGGCGACGGGCCGAGGTTGAGCT
GACGATTGGTGAGCTCGTTCGCATCACGTCACCTCTGCCCCTGGGAGATGCCCCATGCTAAATATGTATCCTGCA
GACGGAAAGAAGGTGTCTATCGAAGGTGAATTCGAGCCCTCATGGCCGACTCTGATGTCTCTGCTCACTCATCAG
ATAGCGGGCTCTGCCCTGATCCAAGCCTGCGAAAAGGCTGGCGTCACGGTTCCCCGGTATGCCACCCGGTGTTGG
AGCATAGCTGCCTGACGTAGCATGGCTGACGTGAATGACTAGATTCTGCTATCATGAGTGAGAGGACCATAACCT
GTCCCTGTTCCATCGAACCGAACTCTGACAATCCCATCTTAGAAAACTCATGATCGCCGGCAACTGCCGAATGTG
CTTGGTCGAGGTCGAGCGGGCGCCCAAACCAGTCGCCTCGTGTGCTTGGCCTGTCCAGCCCGGCATGGTGGTCAA
GACCAACTCACCCCTCACACACAAGGCTCGCGAGGGAGTCATGGAATTCCTCCTCGCCAACCACCCCCTCGACTG
TCCCATCTGCGATCAGGGCGGCGAGTGCGATCTACAGGATCAGTCGATGCGCTACGGCGCTGACCGAGGACGATT
TCACGAGATGGGCGGCAAGCGAGCCGTCGAGGACAAGAACATCGGTCCGCTGATCAAGACGTCGATGAACCGGTG
CATTCACTGCACCCGATGCGTGCGTTTCGCCAACGACGTCGCCGGTGCTCCGGAGCTGGGTTCTACCGGGCGTGG
CAACGATCTGCAGATCGGCACCTACCTCGAGCAGAACCTCGACTCGGAGCTCTCCGCCAACGTCATCGATCTCTG
CCCCGTCGGTGCGCTGACGTCGAAGCCGTATGCGTTCCGGGCCCGACCCTGGGAGCTCAAGCACACCGAGTCCGT
CGACGTTCTCGACGGCTTGGGATCCAACATTCGCATCGACTCCAGAGGTCTCGAGGTGATGCGCATTCTGCCCCG
CCTCAACGACGACGTCAACGAGGAATGGATCAACGACAAGACACGATTCGCCTGCGATGGCCTCAAGACGCAGCG
TCTGACGATGCCGCTGGTCCGACGCGAGGGCAGACTCGAGCCCGCAGAGTGGGAAGAGGCCCTCTGCGAGGTGGC
CAGAGCGTGGGGACAGAAGAAGCCTCAGGGCAACGAGTTCAAGGTGATTGCTGGTGCCCTGACCGACGTCGAATC
CCTGGTCCTGGCCAAGGAGCTCGCCAATAAGCTGGGGTCCGAGAATCTGGCCTTGGACACTCCCGGTGGAGGCCG
CCCGCTGGCACACGGCGTCGACGTGCGGTCGAATTACCTCTTCAACTCGACCATCTGGGGCATCGAAGAGGCGGA
CTGCATCCTCATCGTCGGATGCAACCCGCGCCTCGAGGCGGCGGTTCTGAATGCTCGCATCCGGAAGCAGTGGCT
ACGTTCCGACCTCGAGATCGGCGTAGTCGGCCAGACCTGGGACTCGACCTTTGAGTTTGAGCACTTGGGCGTCGA
TCTCGCTGCCCTCAAGAAGGCGCTGGCCGGTCCCTTTGGCAAGAAGCTCCAGGAGGCGAAGAGGCCGATGATGAT
TGTCGGTTCCGGCGTCACCGACCACGTTGATGCCAGGGCCTTTTACGAGACGATGGGTGCATTCGTACACAAGAA
CGCGGCAAAGTTCACGACGGACGAGTGGAACGGCTTCAACGTGCTGCAGAGGGAAGCCTCGAGGGCGGGCGCCTT
CGAGGTCGGTTTCGTGACGCCGTCGGCTGCCGTTGCCGAGACGAAGCCCAAGTTCCTGTGGCTGCTGGGCGCAGA
CGAGCTGGGAGCGGCCGACATCCCCAAGGATGCCTTTGTCGTCTATCAGGGTCATCACGGCGACCGTGGCGCGCA
GCTCGCAGACGTCATCCTACCCGGTGCCGCTTACACGGAGAAGACGAGCACGTACGTCAACACCGAGGGGCGGGC
GCAGACGACGCGCGCGGCCACGTCACTGCCCGGTGCGTCACGAGCCGACTGGAAGATCCTGCGGGCGGCCAGCGA
GTTTCTCGGCGCGCCGCTGCCCTACGATGACGTCGAGGCCGTGAGGGATCGCATGGCCGAGATCAGCCCGGCCCT
GTTGGCCTACGGCGTCGTCGAGCCCGTGGCGTTGCAGCAGCTGAGCAAGGTGCAGCTGGTGGACCAGAACAAGGG
CGCCAAGGTGGCCGGATCGCCGCTGGAGAATGTCATTGAAAACTTTTACTTTACAGACGTCATCTCTCGGAGGCA
AGTTTTCCCACACGTGACCCTGACTTTGTCCGATACTGACCGGGAGTCATCTCGCGCAGCTCACCGACCATGGCT
CGCTGCTCGGCAGCCAAGGCGGCGAGGGATCCGAGGACGAACTTTATGGCTCCGGGCATGGAGGAGGACAAGCCG
ATGGGTCAGGTAGAGTACGGGGTGTGACGGGCGCCATCATGGGACACGAAAGAGAGAACGGAAAGACGGATGTCT
CTCGAGACGAAAAACAGATGCAGTTTATTTTTGGGGGGGGTTTGATCGGCGTTGGCCTGGTGCTGTCAATGTATA
AATAAGTAGGTGATTCAACGCCAAAGAGGTGTTCAGGAGGTGGCATCGAATTCATCTACCTTTTCGCAAGCAGTC
TCGAGCTCATCGTCCGACCTCAAGGGCCAGAAGGCCGTTGAGCGTTTCCGAAGCCGCGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail