Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5531
Gene name
LocationContig_550:9459..11681
Strand-
Gene length (bp)2222
Transcript length (bp)2097
Coding sequence length (bp)2097
Protein length (aa) 699

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 7.1E-22 254 541
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.5E-13 255 477
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 9.5E-08 141 417

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 67 695 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 255 577 8.0E-12
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 230 535 2.0E-11
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 282 539 4.0E-11
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 255 550 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 67 695 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 255 577 8.0E-12
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 230 535 2.0E-11
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 282 539 4.0E-11
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 255 550 7.0E-11
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 255 552 9.0E-11
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 254 427 1.0E-10
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 255 429 2.0E-10
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 255 429 1.0E-09
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 128 470 2.0E-09
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 254 429 2.0E-09
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 281 474 3.0E-09
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 255 535 5.0E-09
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 307 433 1.0E-08
sp|P0C0H1|HASA_STRP1 Hyaluronan synthase OS=Streptococcus pyogenes serotype M1 GN=hasA PE=3 SV=1 141 424 1.0E-08
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 281 457 1.0E-08
sp|P0C0H0|HASA_STRPY Hyaluronan synthase OS=Streptococcus pyogenes GN=hasA PE=3 SV=1 141 419 2.0E-08
sp|Q8NKX1|HASA_STRP8 Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hasA PE=3 SV=1 141 419 2.0E-08
sp|Q5X9A9|HASA_STRP6 Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hasA PE=3 SV=1 141 419 2.0E-08
sp|P0DB61|HASA_STRPQ Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hasA PE=3 SV=1 141 419 2.0E-08
sp|P0DB60|HASA_STRP3 Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hasA PE=3 SV=1 141 419 2.0E-08
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 281 431 2.0E-08
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 141 470 2.0E-08
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 307 484 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 20 41 21
2 54 76 22
3 99 121 22
4 451 468 17
5 472 494 22
6 501 523 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5531
MTAMNEWPVRDVVYTSVVGVVMVMACLEWFLWLAAFIYCLVKVFRKAEHWSIRLLCIGVGVAFTLLRFIFLPIMV
VTLPLPTQVSQHWPVTAVSFLQWFAFWSFAILLTVPWLFCIYQLVINQLGRTKRIKRVLDDVTAPKVVIVMPCYR
EELDVLVKAIDSVVDCDYPPACIHVFLSFDGDQVDDLYLNTVEMLGVSLSGGAAYPRSIDVTYKAARITVSRFPH
GGKRHCQKSTFKLIDKVYAQYLMRNDNLFILFIDSDCILDKVCLQNFVYDMELSPGNTRDMLAMTGVITSTTRKH
SIITLLQDMEYIHGQLFERTVESGCGSVTCLPGALTMLRFSAFRRMAKYYFADKAEQCDDLFDFAKCHLGEDRWL
THLFMIGAKKRHQIQMCTSAFCKTEAVQTYRSLVKQRRRWFLGFVTNEVCMLTDWRLWKRYPTLIIVRFMQNTIR
TTALLFFIMVLALSTTVVKVDNLPVGFIAVSLGLNWLLMLYFGAKLRRFKVWLYPLMFILNPFFNWYYMVYGILT
AGQRTWGGPRADAAAADSNTTAREAVERAEKQGDELNVVPESFKPAQEARRVASKSRPSTVEICRQRSVVRPPDQ
IDGKFSVRRRMATGIYAHPDESAALGRDIPTTRLDGSLNWYESLESFDSCRSDYKSSSAVMKVEKFMGQEDRRKY
VIAQNMARCSASDRERVSGNTTS*
Coding >Ophun1|5531
ATGACGGCAATGAACGAGTGGCCGGTCAGAGACGTCGTCTACACGTCCGTAGTCGGGGTAGTGATGGTCATGGCC
TGTCTCGAATGGTTCCTTTGGCTCGCGGCCTTTATCTACTGTCTGGTCAAGGTATTCCGGAAAGCTGAGCACTGG
TCTATCCGTCTCCTTTGCATTGGCGTGGGCGTTGCCTTTACATTGCTTCGCTTCATCTTTCTGCCCATCATGGTG
GTCACGCTTCCTCTTCCGACTCAGGTTTCGCAGCACTGGCCAGTGACCGCAGTGTCCTTTCTGCAATGGTTTGCC
TTTTGGAGTTTCGCCATCCTACTTACGGTGCCCTGGCTGTTTTGCATTTATCAGCTTGTCATCAATCAGCTCGGC
CGGACCAAGCGCATCAAGCGGGTGCTCGACGACGTAACCGCTCCAAAGGTAGTTATTGTTATGCCCTGCTACCGT
GAAGAGCTTGATGTACTGGTGAAGGCCATCGACTCAGTTGTCGACTGCGATTATCCGCCGGCTTGTATTCACGTG
TTTCTGTCGTTCGACGGCGACCAGGTGGACGATCTCTACCTCAACACCGTGGAGATGTTAGGAGTGTCTCTTTCC
GGGGGAGCAGCTTACCCAAGGAGCATCGACGTGACATACAAGGCGGCACGCATCACCGTCTCCCGCTTCCCACAC
GGCGGCAAGCGACATTGCCAAAAATCTACCTTCAAACTCATTGACAAAGTCTACGCGCAGTATCTGATGAGAAAC
GACAATCTTTTTATCCTATTTATCGACTCTGATTGCATTCTAGACAAGGTCTGTTTGCAGAATTTTGTCTACGAT
ATGGAGCTCAGCCCCGGAAACACTAGGGATATGCTGGCAATGACAGGCGTCATAACGTCAACGACGCGCAAGCAC
AGCATCATCACGCTCCTCCAAGACATGGAGTATATTCACGGACAGTTGTTCGAGCGCACTGTCGAGTCCGGGTGC
GGATCAGTCACATGTCTGCCAGGCGCGCTCACCATGCTTCGCTTCTCGGCTTTCAGAAGAATGGCCAAGTATTAT
TTTGCGGACAAAGCGGAGCAATGCGATGATCTGTTTGACTTCGCGAAATGCCATTTGGGCGAAGATCGTTGGCTC
ACACATCTGTTCATGATTGGGGCGAAAAAACGACACCAAATCCAGATGTGCACGTCTGCCTTTTGCAAGACAGAA
GCTGTGCAGACGTATCGGTCTCTGGTTAAGCAGCGGCGCCGATGGTTTCTCGGCTTTGTTACTAATGAGGTCTGC
ATGCTGACCGACTGGCGACTGTGGAAGCGATATCCGACCTTGATTATCGTGCGCTTCATGCAGAACACCATTCGT
ACCACAGCCCTACTTTTTTTCATCATGGTACTGGCCTTGTCGACGACTGTTGTCAAGGTCGACAACCTCCCGGTG
GGATTCATTGCCGTTTCGCTGGGTCTCAATTGGCTTCTGATGCTCTACTTCGGCGCCAAATTGCGACGCTTCAAA
GTCTGGCTGTATCCCTTAATGTTCATCCTAAATCCGTTCTTCAACTGGTATTACATGGTTTACGGAATTCTCACT
GCCGGCCAGAGAACCTGGGGCGGGCCGCGAGCCGATGCTGCGGCCGCCGATAGCAATACGACGGCCCGAGAGGCC
GTGGAGCGAGCCGAGAAGCAAGGCGATGAACTCAATGTCGTTCCGGAGTCTTTCAAGCCGGCTCAAGAGGCGCGG
AGAGTCGCAAGCAAGTCGCGCCCCTCCACGGTGGAAATTTGCCGGCAGAGGAGTGTTGTAAGACCTCCAGATCAA
ATCGATGGCAAATTCTCGGTTCGACGAAGAATGGCGACGGGAATCTATGCGCATCCCGATGAAAGCGCAGCATTA
GGTAGAGACATACCCACCACAAGGCTAGATGGCTCGCTCAATTGGTATGAGTCGCTGGAAAGCTTTGACTCCTGT
CGCTCAGACTACAAATCTTCATCTGCCGTGATGAAGGTTGAAAAGTTTATGGGACAAGAGGATCGACGCAAATAT
GTCATAGCGCAAAACATGGCCAGATGTAGCGCCAGCGATAGAGAACGGGTTTCGGGAAATACTACCAGTTAG
Transcript >Ophun1|5531
ATGACGGCAATGAACGAGTGGCCGGTCAGAGACGTCGTCTACACGTCCGTAGTCGGGGTAGTGATGGTCATGGCC
TGTCTCGAATGGTTCCTTTGGCTCGCGGCCTTTATCTACTGTCTGGTCAAGGTATTCCGGAAAGCTGAGCACTGG
TCTATCCGTCTCCTTTGCATTGGCGTGGGCGTTGCCTTTACATTGCTTCGCTTCATCTTTCTGCCCATCATGGTG
GTCACGCTTCCTCTTCCGACTCAGGTTTCGCAGCACTGGCCAGTGACCGCAGTGTCCTTTCTGCAATGGTTTGCC
TTTTGGAGTTTCGCCATCCTACTTACGGTGCCCTGGCTGTTTTGCATTTATCAGCTTGTCATCAATCAGCTCGGC
CGGACCAAGCGCATCAAGCGGGTGCTCGACGACGTAACCGCTCCAAAGGTAGTTATTGTTATGCCCTGCTACCGT
GAAGAGCTTGATGTACTGGTGAAGGCCATCGACTCAGTTGTCGACTGCGATTATCCGCCGGCTTGTATTCACGTG
TTTCTGTCGTTCGACGGCGACCAGGTGGACGATCTCTACCTCAACACCGTGGAGATGTTAGGAGTGTCTCTTTCC
GGGGGAGCAGCTTACCCAAGGAGCATCGACGTGACATACAAGGCGGCACGCATCACCGTCTCCCGCTTCCCACAC
GGCGGCAAGCGACATTGCCAAAAATCTACCTTCAAACTCATTGACAAAGTCTACGCGCAGTATCTGATGAGAAAC
GACAATCTTTTTATCCTATTTATCGACTCTGATTGCATTCTAGACAAGGTCTGTTTGCAGAATTTTGTCTACGAT
ATGGAGCTCAGCCCCGGAAACACTAGGGATATGCTGGCAATGACAGGCGTCATAACGTCAACGACGCGCAAGCAC
AGCATCATCACGCTCCTCCAAGACATGGAGTATATTCACGGACAGTTGTTCGAGCGCACTGTCGAGTCCGGGTGC
GGATCAGTCACATGTCTGCCAGGCGCGCTCACCATGCTTCGCTTCTCGGCTTTCAGAAGAATGGCCAAGTATTAT
TTTGCGGACAAAGCGGAGCAATGCGATGATCTGTTTGACTTCGCGAAATGCCATTTGGGCGAAGATCGTTGGCTC
ACACATCTGTTCATGATTGGGGCGAAAAAACGACACCAAATCCAGATGTGCACGTCTGCCTTTTGCAAGACAGAA
GCTGTGCAGACGTATCGGTCTCTGGTTAAGCAGCGGCGCCGATGGTTTCTCGGCTTTGTTACTAATGAGGTCTGC
ATGCTGACCGACTGGCGACTGTGGAAGCGATATCCGACCTTGATTATCGTGCGCTTCATGCAGAACACCATTCGT
ACCACAGCCCTACTTTTTTTCATCATGGTACTGGCCTTGTCGACGACTGTTGTCAAGGTCGACAACCTCCCGGTG
GGATTCATTGCCGTTTCGCTGGGTCTCAATTGGCTTCTGATGCTCTACTTCGGCGCCAAATTGCGACGCTTCAAA
GTCTGGCTGTATCCCTTAATGTTCATCCTAAATCCGTTCTTCAACTGGTATTACATGGTTTACGGAATTCTCACT
GCCGGCCAGAGAACCTGGGGCGGGCCGCGAGCCGATGCTGCGGCCGCCGATAGCAATACGACGGCCCGAGAGGCC
GTGGAGCGAGCCGAGAAGCAAGGCGATGAACTCAATGTCGTTCCGGAGTCTTTCAAGCCGGCTCAAGAGGCGCGG
AGAGTCGCAAGCAAGTCGCGCCCCTCCACGGTGGAAATTTGCCGGCAGAGGAGTGTTGTAAGACCTCCAGATCAA
ATCGATGGCAAATTCTCGGTTCGACGAAGAATGGCGACGGGAATCTATGCGCATCCCGATGAAAGCGCAGCATTA
GGTAGAGACATACCCACCACAAGGCTAGATGGCTCGCTCAATTGGTATGAGTCGCTGGAAAGCTTTGACTCCTGT
CGCTCAGACTACAAATCTTCATCTGCCGTGATGAAGGTTGAAAAGTTTATGGGACAAGAGGATCGACGCAAATAT
GTCATAGCGCAAAACATGGCCAGATGTAGCGCCAGCGATAGAGAACGGGTTTCGGGAAATACTACCAGTTAG
Gene >Ophun1|5531
ATGACGGCAATGAACGAGTGGCCGGTCAGAGACGTAGGTCTACCCATGAGCACTACCTACCCGTGTGCACCGACT
GTTGCTCACCAGTCACCACTGAGGCAGGTCGTCTACACGTCCGTAGTCGGGGTAGTGATGGTCATGGCCTGTCTC
GAATGGTTCCTTTGGCTCGCGGCCTTTATCTACTGTCTGGTCAAGGTATTCCGGAAAGCTGAGCACTGGTCTATC
CGTCTCCTTTGCATTGGCGTGGGCGTTGCCTTTACATTGCTTCGGTACGTCCATAGGCTTTGATGCGTAGGTAGG
AACCCAATGGCGCTGACCAGAACAGCTTCATCTTTCTGCCCATCATGGTGGTCACGCTTCCTCTTCCGACTCAGG
TTTCGCAGCACTGGCCAGTGACCGCAGTGTCCTTTCTGCAATGGTTTGCCTTTTGGAGTTTCGCCATCCTACTTA
CGGTGCCCTGGCTGTTTTGCATTTATCAGCTTGTCATCAATCAGCTCGGCCGGACCAAGCGCATCAAGCGGGTGC
TCGACGACGTAACCGCTCCAAAGGTAGTTATTGTTATGCCCTGCTACCGTGAAGAGCTTGATGTACTGGTGAAGG
CCATCGACTCAGTTGTCGACTGCGATTATCCGCCGGCTTGTATTCACGTGTTTCTGTCGTTCGACGGCGACCAGG
TGGACGATCTCTACCTCAACACCGTGGAGATGTTAGGAGTGTCTCTTTCCGGGGGAGCAGCTTACCCAAGGAGCA
TCGACGTGACATACAAGGCGGCACGCATCACCGTCTCCCGCTTCCCACACGGCGGCAAGCGACATTGCCAAAAAT
CTACCTTCAAACTCATTGACAAAGTCTACGCGCAGTATCTGATGAGAAACGACAATCTTTTTATCCTATTTATCG
ACTCTGATTGCATTCTAGACAAGGTCTGTTTGCAGAATTTTGTCTACGATATGGAGCTCAGCCCCGGAAACACTA
GGGATATGCTGGCAATGACAGGCGTCATAACGTCAACGACGCGCAAGCACAGCATCATCACGCTCCTCCAAGACA
TGGAGTATATTCACGGACAGTTGTTCGAGCGCACTGTCGAGTCCGGGTGCGGATCAGTCACATGTCTGCCAGGCG
CGCTCACCATGCTTCGCTTCTCGGCTTTCAGAAGAATGGCCAAGTATTATTTTGCGGACAAAGCGGAGCAATGCG
ATGATCTGTTTGACTTCGCGAAATGCCATTTGGGCGAAGATCGTTGGCTCACACATCTGTTCATGATTGGGGCGA
AAAAACGACACCAAATCCAGATGTGCACGTCTGCCTTTTGCAAGACAGAAGCTGTGCAGACGTATCGGTCTCTGG
TTAAGCAGCGGCGCCGATGGTTTCTCGGCTTTGTTACTAATGAGGTCTGCATGCTGACCGACTGGCGACTGTGGA
AGCGATATCCGACCTTGATTATCGTGCGCTTCATGCAGAACACCATTCGTACCACAGCCCTACTTTTTTTCATCA
TGGTACTGGCCTTGTCGACGACTGTTGTCAAGGTCGACAACCTCCCGGTGGGATTCATTGCCGTTTCGCTGGGTC
TCAATTGGCTTCTGATGCTCTACTTCGGCGCCAAATTGCGACGCTTCAAAGTCTGGCTGTATCCCTTAATGTTCA
TCCTAAATCCGTTCTTCAACTGGTATTACATGGTTTACGGAATTCTCACTGCCGGCCAGAGAACCTGGGGCGGGC
CGCGAGCCGATGCTGCGGCCGCCGATAGCAATACGACGGCCCGAGAGGCCGTGGAGCGAGCCGAGAAGCAAGGCG
ATGAACTCAATGTCGTTCCGGAGTCTTTCAAGCCGGCTCAAGAGGCGCGGAGAGTCGCAAGCAAGTCGCGCCCCT
CCACGGTGGAAATTTGCCGGCAGAGGAGTGTTGTAAGACCTCCAGATCAAATCGATGGCAAATTCTCGGTTCGAC
GAAGAATGGCGACGGGAATCTATGCGCATCCCGATGAAAGCGCAGCATTAGGTAGAGACATACCCACCACAAGGC
TAGATGGCTCGCTCAATTGGTATGAGTCGCTGGAAAGCTTTGACTCCTGTCGCTCAGACTACAAATCTTCATCTG
CCGTGATGAAGGTTGAAAAGTTTATGGGACAAGAGGATCGACGCAAATATGTCATAGCGCAAAACATGGCCAGAT
GTAGCGCCAGCGATAGAGAACGGGTTTCGGGAAATACTACCAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail