Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5526
Gene name
LocationContig_55:42030..47189
Strand+
Gene length (bp)5159
Transcript length (bp)5028
Coding sequence length (bp)5028
Protein length (aa) 1676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 7.1E-58 1336 1619
PF00621 RhoGEF RhoGEF domain 1.5E-37 867 1051
PF15405 PH_5 Pleckstrin homology domain 8.8E-09 1090 1248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 703 1667 5.0E-108
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 790 1628 2.0E-55
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 859 1180 5.0E-23
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 1325 1622 9.0E-23
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 686 1618 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 703 1667 5.0E-108
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 790 1628 2.0E-55
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 859 1180 5.0E-23
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 1325 1622 9.0E-23
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 686 1618 1.0E-21
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 788 1162 2.0E-19
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 859 1157 1.0E-18
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 859 1157 1.0E-18
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 859 1157 3.0E-18
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 858 1157 8.0E-18
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 858 1157 1.0E-14
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 864 1119 4.0E-14
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 864 1119 9.0E-14
sp|Q8N5V2|NGEF_HUMAN Ephexin-1 OS=Homo sapiens GN=NGEF PE=1 SV=2 844 1197 1.0E-13
sp|Q5RDX5|NGEF_PONAB Ephexin-1 OS=Pongo abelii GN=NGEF PE=2 SV=1 844 1197 1.0E-13
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 868 1119 2.0E-13
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 832 1166 3.0E-13
sp|Q8CHT1|NGEF_MOUSE Ephexin-1 OS=Mus musculus GN=Ngef PE=1 SV=1 859 1197 3.0E-13
sp|Q5BKC9|NGEF_RAT Ephexin-1 OS=Rattus norvegicus GN=Ngef PE=1 SV=2 859 1197 2.0E-12
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 1333 1619 5.0E-12
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 864 1155 1.0E-11
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 832 1124 1.0E-11
sp|Q11100|TAG52_CAEEL Putative protein tag-52 OS=Caenorhabditis elegans GN=tag-52 PE=3 SV=1 867 1119 3.0E-11
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 868 1155 5.0E-11
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 864 1155 1.0E-10
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 842 1157 2.0E-10
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 860 1157 2.0E-10
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 859 1157 4.0E-10
sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=1 SV=1 822 1119 4.0E-10
sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 868 1119 8.0E-10
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 832 1123 8.0E-10
sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 868 1119 1.0E-09
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 860 1136 1.0E-09
sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=1 SV=1 867 1119 3.0E-09
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 828 1089 5.0E-09
sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 859 1155 1.0E-08
sp|Q5VV41|ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens GN=ARHGEF16 PE=1 SV=1 859 1122 2.0E-08
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 828 1089 2.0E-08
sp|Q3U5C8|ARHGG_MOUSE Rho guanine nucleotide exchange factor 16 OS=Mus musculus GN=Arhgef16 PE=1 SV=3 859 1122 4.0E-08
sp|Q60875|ARHG2_MOUSE Rho guanine nucleotide exchange factor 2 OS=Mus musculus GN=Arhgef2 PE=1 SV=4 827 1126 2.0E-07
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 859 1061 3.0E-07
sp|Q5FVC2|ARHG2_RAT Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus GN=Arhgef2 PE=1 SV=1 827 1126 5.0E-07
sp|O94989|ARHGF_HUMAN Rho guanine nucleotide exchange factor 15 OS=Homo sapiens GN=ARHGEF15 PE=1 SV=4 859 1102 7.0E-07
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 858 1061 8.0E-07
sp|Q8N1W1|ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens GN=ARHGEF28 PE=1 SV=3 861 1059 1.0E-06
sp|P97433|ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus GN=Arhgef28 PE=1 SV=1 831 1059 5.0E-06
sp|P0C6P5|ARG28_RAT Rho guanine nucleotide exchange factor 28 OS=Rattus norvegicus GN=Arhgef28 PE=1 SV=1 831 1059 5.0E-06
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 859 1064 6.0E-06
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 859 1064 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0003674 molecular_function No
GO:0030695 GTPase regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5526
MSFRADDQRRYGHVPPVQYPVPGHPPDRQAAGRRLSFNSGDDAAYYGPQSPAAPPHHPSAEDELFFNPSSTSPSA
YGSSNSAYQRQYQSTTPRTPPTHSTYNPQAFSTPSASAALRNSPSAAPPHQPHSSPRYSGSSYGTSPPAGYAPQV
YNPAAYADTNGHQRQPVHSGYPQDQVYAAVRGQSPASAYTAAFPHQLPSAGQSVGQAFTYDPSQYASYGDAQSSA
SHASVSHLPYPTTSQIPVGPNYQDQTSYFGRPVRSDSQQSSRASPYMHPHSPSGLQRHPTNAPLPSRPMDEPMDE
PYWDVNGRLSGRERNLERVTPESIMEEIEAELGETSLRSRRRPSPMNGQPSQEQAQRAPPHVPPHSPSASPGRAP
VHYDDEDDDDDDDDPEGTAGVLAMRQAELDEERFSGNAFMYSDFPAPLPVPPKNPLPPPPELQDASSDSDFGSNV
DLGIMSGGHAGDLAYGEHVGSFSGASSLPAVSRPLPMPTYGAESYGETPFNAEMDYVGTGGLRAPRASRLSFDEG
RDERVSIHSGDSRRSGTESPVKDDYQDLFYHPGLSSRPLPALPPGPGSDSSSMLSAHNSLRSQNQNQHQHSLSAD
ARYYQADAPEAFYQSTSQQMLQPERSISLSGHSHTPQVQAPTRSRTDATEERKKMNRQQQMVLQQGPVLSEHNES
GPGLPPGAFDSITLPSGRKKKFVPSKLSASDFRKCQEAWALSAIEAWVRLMGEGEIDLKEKTVEEAVTNLFAFKV
PTMNVADAETLSSHVVRLMLDSGLLLPDEEWVKFGDGHISGILWQLTGSGCYAPKLHAFETSGHCYSHLCTRTVR
KFELDDLESDDAEKKEWHVYHNLTPEEISAKGGKEVARQNNLHEIVTGEHHYVKQLDIFRNIYRESLRRRQPPII
HPEKQEKFFNAVFGNMDAVSAVHKQHLLSRLRHRRDAQGPWIVGFSDIFREWIRKAKSDYIEYAACYPRAKYLLQ
KESERNVLFQKFNEEMRKDKASSKQDWTHFLLAPIQRLPRYILLLETVDKNTVDESEEKTNLQRAIQEIRTVTIE
CDAKVAETEARVHMMALDQMLVLRPGFQSVLNLHHLGRALIKQGELQRMGSKGMRWVDTHALLFDHYLILSKVVF
TKDGRAEKKFDVSREPIPMPLLLLESMNDEPVTKQKVITAPLSRTTAASASGTQLNKATSNGGGRQALEHAATGS
SMSSLTTVTTFDSESKVIYPFRVKHLGHEVYTLHAPSARDRRDWCMSIIDAKTRHAESLFSQNAEPFRLRVLADA
SFHYDANSIYMRASGVHVKGTPLDRAIQELESVMGSSQGIAPVCRAQVNCAAGFSAFGRPLLAIGTDYGIFVTDP
AEPRGWRRTVQTARVTQMAVLEEFAVCLAIADKSLVSYPLDVVAPNSDLAPPMSDSPRRAPQRLAKDVTYFATAR
MKDRTLVFYKRKEGLHTSFKVLEPILHKATEKRSRFGRRAIARSTDTFRDFDEFYLPTECYSLSLFQTYIAVATA
KGIEMLTLDKKQPMSIPDLKAPAIANIAGRVRDQRPLGMFRLNDSEFILTYEDCAVYVDKHGDVSRTLIMEYTGK
QKKARSATMYGQYLLLFNDDYVEVRNADNGRLRQIIAGRDVRVIDFGVRGPTGGNASATQANGHAPGDVSKGTVK
ISMCHPEQAGKQIVLEMLLNDGHVD*
Coding >Ophun1|5526
ATGTCGTTCCGCGCCGACGATCAGCGTCGCTACGGCCACGTTCCGCCCGTCCAGTATCCCGTTCCCGGCCATCCT
CCCGACCGTCAGGCAGCGGGTCGTCGTCTGAGCTTCAACAGCGGCGACGACGCTGCCTACTACGGCCCTCAGTCG
CCCGCTGCCCCTCCTCATCATCCCTCCGCCGAGGACGAACTCTTCTTCAACCCCAGTTCCACCAGCCCTTCGGCT
TATGGCTCATCCAACAGCGCCTACCAACGCCAGTATCAGAGCACCACGCCCCGTACGCCCCCGACTCATTCCACC
TACAATCCCCAGGCCTTTTCCACCCCATCCGCCTCGGCCGCTCTGCGAAACTCCCCGTCGGCCGCTCCCCCTCAT
CAGCCGCACTCGTCGCCGCGATACTCGGGCAGCTCCTACGGCACCTCTCCTCCGGCTGGTTACGCCCCGCAGGTC
TATAATCCAGCCGCCTACGCCGACACAAACGGACATCAGCGTCAGCCTGTTCACTCCGGCTATCCTCAAGACCAA
GTCTACGCCGCCGTGCGTGGCCAGTCGCCGGCCTCGGCCTATACAGCTGCCTTTCCTCACCAGCTGCCCTCTGCC
GGCCAGTCTGTTGGCCAAGCCTTTACCTATGACCCTTCTCAGTATGCCTCGTACGGTGACGCCCAGTCGTCGGCC
TCGCACGCTTCCGTCTCCCACCTCCCGTATCCCACCACGTCGCAAATACCCGTCGGCCCCAACTACCAGGACCAG
ACCTCGTACTTTGGCCGTCCCGTTCGGTCAGACTCGCAGCAGTCTTCGCGAGCCTCTCCCTACATGCATCCGCAC
TCGCCTTCTGGTCTCCAGAGGCACCCGACCAACGCGCCCCTTCCGAGCCGGCCGATGGACGAGCCGATGGATGAG
CCTTACTGGGACGTCAATGGCCGGCTTTCGGGCAGGGAACGCAACCTGGAGCGGGTGACGCCCGAGAGCATCATG
GAGGAAATCGAGGCCGAGCTGGGCGAGACCAGCCTCCGATCCCGACGGCGCCCATCCCCGATGAACGGCCAGCCG
TCTCAAGAGCAGGCCCAGCGGGCGCCGCCTCATGTCCCACCGCACTCTCCTTCGGCGTCTCCGGGCAGAGCTCCG
GTCCACTACGATGACGAAGACGACGATGACGACGATGACGACCCCGAAGGAACCGCGGGTGTGCTGGCCATGCGA
CAGGCTGAACTGGACGAAGAGCGGTTCAGCGGCAACGCCTTCATGTACAGCGACTTTCCTGCGCCCTTGCCGGTC
CCCCCCAAAAACCCCTTGCCTCCGCCGCCCGAGCTGCAGGATGCCAGCAGCGACAGCGACTTTGGGAGCAACGTC
GACCTGGGCATCATGAGTGGTGGCCACGCCGGCGACTTGGCATATGGCGAGCATGTCGGATCCTTCTCCGGTGCC
TCCTCTTTGCCAGCAGTCTCACGGCCCTTGCCGATGCCGACTTACGGGGCCGAGAGCTACGGCGAGACGCCCTTC
AACGCCGAGATGGATTATGTCGGCACCGGCGGGTTGCGCGCCCCGAGGGCATCGCGGTTGAGCTTCGACGAAGGC
CGGGATGAGAGGGTTTCCATTCACTCGGGAGACTCGCGGCGGAGCGGCACCGAGTCGCCCGTCAAGGACGATTAC
CAGGACCTCTTTTACCATCCCGGCCTCTCCAGCAGGCCGTTGCCGGCTTTGCCTCCGGGCCCCGGCTCAGACAGC
AGCTCGATGTTGTCGGCTCACAACAGCCTCCGTTCGCAGAATCAGAACCAGCACCAGCACTCGCTGAGCGCAGAC
GCCCGCTACTACCAGGCCGACGCTCCCGAGGCCTTTTACCAGTCAACATCGCAGCAGATGCTGCAGCCGGAGAGA
TCCATCTCGCTCTCCGGTCACAGCCACACGCCGCAGGTACAGGCCCCTACGAGATCGCGGACGGATGCGACAGAG
GAGCGCAAAAAGATGAATCGGCAGCAGCAAATGGTCCTGCAGCAGGGACCGGTACTCTCGGAGCACAATGAGTCG
GGTCCCGGCCTCCCTCCCGGCGCCTTTGACAGCATCACGTTGCCGAGCGGGCGCAAGAAGAAGTTTGTGCCGTCG
AAGCTGTCGGCGTCGGACTTTCGCAAGTGCCAGGAAGCATGGGCACTCAGCGCCATCGAGGCGTGGGTGCGGCTG
ATGGGAGAAGGCGAGATTGATCTCAAAGAGAAGACGGTGGAAGAGGCGGTGACGAACCTGTTTGCCTTCAAGGTG
CCGACGATGAACGTTGCGGATGCCGAGACGCTCAGCAGCCACGTGGTCCGGCTCATGCTCGACTCTGGCCTCTTG
CTACCGGACGAGGAATGGGTCAAGTTTGGCGACGGGCATATATCCGGCATCCTCTGGCAGCTGACCGGTTCGGGC
TGCTACGCCCCCAAGCTTCACGCCTTCGAGACGAGCGGCCACTGCTACTCGCATCTGTGCACGCGTACCGTCCGC
AAGTTTGAGCTGGACGACCTGGAGTCGGACGACGCCGAGAAGAAGGAATGGCACGTCTACCACAACCTGACGCCG
GAAGAGATCAGCGCCAAGGGCGGCAAGGAGGTGGCGCGACAGAACAATCTGCACGAGATTGTCACGGGCGAGCAC
CACTACGTCAAGCAGCTGGACATCTTTCGCAACATTTACCGCGAGAGCCTGCGGAGGCGGCAGCCGCCCATCATC
CACCCGGAGAAGCAGGAAAAGTTCTTCAACGCCGTCTTTGGCAACATGGACGCCGTATCGGCCGTTCACAAGCAG
CACCTCCTGTCGCGGCTCAGGCACAGGCGAGACGCCCAGGGCCCGTGGATCGTCGGCTTCAGCGACATCTTTCGA
GAATGGATACGCAAGGCCAAGTCGGACTACATCGAATATGCGGCCTGCTATCCGCGGGCCAAGTATCTGCTGCAG
AAGGAGTCGGAGCGCAATGTCTTGTTCCAAAAGTTTAACGAGGAGATGCGCAAGGACAAGGCGTCTTCGAAGCAG
GACTGGACTCATTTCTTGCTTGCCCCTATCCAGCGGCTGCCGCGGTACATTCTTTTGTTGGAAACGGTGGACAAG
AACACGGTGGACGAGAGCGAGGAAAAGACGAACCTGCAGAGGGCCATCCAGGAGATCCGGACGGTGACGATTGAG
TGCGACGCCAAGGTGGCCGAGACGGAGGCTCGGGTGCACATGATGGCGTTGGACCAGATGCTCGTGCTGCGCCCT
GGCTTCCAGTCGGTGCTGAACCTTCACCACCTCGGCAGGGCCCTCATCAAGCAGGGCGAGCTGCAGAGGATGGGA
TCCAAGGGGATGCGATGGGTGGACACGCATGCCCTGCTGTTTGATCACTACCTGATCCTGTCCAAGGTAGTCTTC
ACCAAGGACGGCAGGGCGGAGAAGAAGTTTGACGTGTCGCGAGAGCCCATTCCGATGCCGCTGCTGCTTCTGGAG
AGCATGAATGACGAGCCGGTGACGAAGCAAAAGGTCATAACGGCGCCGCTGAGCCGGACCACGGCGGCCTCTGCC
TCGGGCACGCAACTCAACAAGGCGACCAGCAACGGCGGAGGCCGGCAAGCGCTCGAGCACGCGGCGACGGGGTCA
TCGATGAGCAGCCTGACGACGGTCACTACGTTTGACTCGGAGAGCAAGGTCATCTATCCGTTCCGGGTGAAGCAC
CTGGGTCACGAGGTGTACACTCTGCACGCCCCGTCGGCGCGGGACCGGCGAGACTGGTGCATGAGCATCATCGAC
GCCAAGACGAGGCACGCCGAGTCGTTGTTCTCGCAGAACGCTGAGCCGTTTCGGCTACGGGTCTTGGCCGATGCC
TCGTTCCACTACGACGCCAACTCGATCTATATGCGTGCCTCGGGCGTGCACGTCAAGGGAACGCCGCTGGACCGG
GCCATCCAGGAGCTGGAGAGCGTCATGGGCTCGTCTCAGGGCATCGCGCCCGTGTGCCGAGCGCAAGTCAACTGC
GCGGCTGGCTTCTCGGCGTTTGGAAGGCCGCTGCTGGCCATCGGGACAGACTACGGCATCTTTGTCACGGACCCG
GCCGAGCCCCGGGGATGGCGTCGGACGGTACAGACAGCGCGGGTGACGCAGATGGCGGTGCTGGAAGAGTTTGCC
GTGTGTCTGGCAATCGCAGACAAGTCGCTCGTGTCGTATCCGCTCGATGTTGTGGCGCCCAACTCGGATCTGGCA
CCGCCCATGAGCGACAGCCCGCGACGGGCACCGCAGCGGCTGGCCAAGGACGTGACGTACTTTGCGACGGCGCGG
ATGAAGGACCGGACGCTCGTCTTCTACAAGCGCAAGGAGGGCCTCCATACGTCGTTTAAGGTGCTGGAGCCCATC
CTCCACAAGGCCACGGAGAAGCGGTCGCGCTTCGGACGGCGGGCGATTGCCCGTAGCACCGACACGTTTCGCGAC
TTTGACGAGTTTTACCTGCCGACAGAGTGCTATTCGCTCAGCCTGTTCCAGACGTACATTGCCGTGGCGACGGCC
AAGGGCATCGAGATGCTCACGTTGGACAAGAAGCAGCCCATGTCGATTCCGGACCTCAAGGCGCCGGCCATTGCG
AATATTGCCGGGCGTGTCCGTGACCAGCGGCCGCTCGGCATGTTTCGACTCAACGACAGCGAGTTCATCCTGACG
TACGAGGACTGCGCCGTCTACGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACTGGCAAG
CAGAAAAAGGCCCGGAGCGCGACCATGTACGGCCAGTACCTGCTGCTCTTCAACGACGACTACGTCGAGGTGCGC
AACGCCGACAACGGCCGACTGCGGCAGATCATCGCCGGCCGCGACGTCCGCGTCATCGACTTTGGCGTCCGGGGC
CCGACGGGGGGGAACGCCTCGGCGACGCAGGCCAACGGGCACGCGCCGGGAGACGTCAGCAAGGGCACCGTCAAG
ATCTCCATGTGCCATCCCGAGCAGGCGGGGAAGCAGATTGTGCTCGAGATGCTGCTCAACGACGGACATGTGGAT
TGA
Transcript >Ophun1|5526
ATGTCGTTCCGCGCCGACGATCAGCGTCGCTACGGCCACGTTCCGCCCGTCCAGTATCCCGTTCCCGGCCATCCT
CCCGACCGTCAGGCAGCGGGTCGTCGTCTGAGCTTCAACAGCGGCGACGACGCTGCCTACTACGGCCCTCAGTCG
CCCGCTGCCCCTCCTCATCATCCCTCCGCCGAGGACGAACTCTTCTTCAACCCCAGTTCCACCAGCCCTTCGGCT
TATGGCTCATCCAACAGCGCCTACCAACGCCAGTATCAGAGCACCACGCCCCGTACGCCCCCGACTCATTCCACC
TACAATCCCCAGGCCTTTTCCACCCCATCCGCCTCGGCCGCTCTGCGAAACTCCCCGTCGGCCGCTCCCCCTCAT
CAGCCGCACTCGTCGCCGCGATACTCGGGCAGCTCCTACGGCACCTCTCCTCCGGCTGGTTACGCCCCGCAGGTC
TATAATCCAGCCGCCTACGCCGACACAAACGGACATCAGCGTCAGCCTGTTCACTCCGGCTATCCTCAAGACCAA
GTCTACGCCGCCGTGCGTGGCCAGTCGCCGGCCTCGGCCTATACAGCTGCCTTTCCTCACCAGCTGCCCTCTGCC
GGCCAGTCTGTTGGCCAAGCCTTTACCTATGACCCTTCTCAGTATGCCTCGTACGGTGACGCCCAGTCGTCGGCC
TCGCACGCTTCCGTCTCCCACCTCCCGTATCCCACCACGTCGCAAATACCCGTCGGCCCCAACTACCAGGACCAG
ACCTCGTACTTTGGCCGTCCCGTTCGGTCAGACTCGCAGCAGTCTTCGCGAGCCTCTCCCTACATGCATCCGCAC
TCGCCTTCTGGTCTCCAGAGGCACCCGACCAACGCGCCCCTTCCGAGCCGGCCGATGGACGAGCCGATGGATGAG
CCTTACTGGGACGTCAATGGCCGGCTTTCGGGCAGGGAACGCAACCTGGAGCGGGTGACGCCCGAGAGCATCATG
GAGGAAATCGAGGCCGAGCTGGGCGAGACCAGCCTCCGATCCCGACGGCGCCCATCCCCGATGAACGGCCAGCCG
TCTCAAGAGCAGGCCCAGCGGGCGCCGCCTCATGTCCCACCGCACTCTCCTTCGGCGTCTCCGGGCAGAGCTCCG
GTCCACTACGATGACGAAGACGACGATGACGACGATGACGACCCCGAAGGAACCGCGGGTGTGCTGGCCATGCGA
CAGGCTGAACTGGACGAAGAGCGGTTCAGCGGCAACGCCTTCATGTACAGCGACTTTCCTGCGCCCTTGCCGGTC
CCCCCCAAAAACCCCTTGCCTCCGCCGCCCGAGCTGCAGGATGCCAGCAGCGACAGCGACTTTGGGAGCAACGTC
GACCTGGGCATCATGAGTGGTGGCCACGCCGGCGACTTGGCATATGGCGAGCATGTCGGATCCTTCTCCGGTGCC
TCCTCTTTGCCAGCAGTCTCACGGCCCTTGCCGATGCCGACTTACGGGGCCGAGAGCTACGGCGAGACGCCCTTC
AACGCCGAGATGGATTATGTCGGCACCGGCGGGTTGCGCGCCCCGAGGGCATCGCGGTTGAGCTTCGACGAAGGC
CGGGATGAGAGGGTTTCCATTCACTCGGGAGACTCGCGGCGGAGCGGCACCGAGTCGCCCGTCAAGGACGATTAC
CAGGACCTCTTTTACCATCCCGGCCTCTCCAGCAGGCCGTTGCCGGCTTTGCCTCCGGGCCCCGGCTCAGACAGC
AGCTCGATGTTGTCGGCTCACAACAGCCTCCGTTCGCAGAATCAGAACCAGCACCAGCACTCGCTGAGCGCAGAC
GCCCGCTACTACCAGGCCGACGCTCCCGAGGCCTTTTACCAGTCAACATCGCAGCAGATGCTGCAGCCGGAGAGA
TCCATCTCGCTCTCCGGTCACAGCCACACGCCGCAGGTACAGGCCCCTACGAGATCGCGGACGGATGCGACAGAG
GAGCGCAAAAAGATGAATCGGCAGCAGCAAATGGTCCTGCAGCAGGGACCGGTACTCTCGGAGCACAATGAGTCG
GGTCCCGGCCTCCCTCCCGGCGCCTTTGACAGCATCACGTTGCCGAGCGGGCGCAAGAAGAAGTTTGTGCCGTCG
AAGCTGTCGGCGTCGGACTTTCGCAAGTGCCAGGAAGCATGGGCACTCAGCGCCATCGAGGCGTGGGTGCGGCTG
ATGGGAGAAGGCGAGATTGATCTCAAAGAGAAGACGGTGGAAGAGGCGGTGACGAACCTGTTTGCCTTCAAGGTG
CCGACGATGAACGTTGCGGATGCCGAGACGCTCAGCAGCCACGTGGTCCGGCTCATGCTCGACTCTGGCCTCTTG
CTACCGGACGAGGAATGGGTCAAGTTTGGCGACGGGCATATATCCGGCATCCTCTGGCAGCTGACCGGTTCGGGC
TGCTACGCCCCCAAGCTTCACGCCTTCGAGACGAGCGGCCACTGCTACTCGCATCTGTGCACGCGTACCGTCCGC
AAGTTTGAGCTGGACGACCTGGAGTCGGACGACGCCGAGAAGAAGGAATGGCACGTCTACCACAACCTGACGCCG
GAAGAGATCAGCGCCAAGGGCGGCAAGGAGGTGGCGCGACAGAACAATCTGCACGAGATTGTCACGGGCGAGCAC
CACTACGTCAAGCAGCTGGACATCTTTCGCAACATTTACCGCGAGAGCCTGCGGAGGCGGCAGCCGCCCATCATC
CACCCGGAGAAGCAGGAAAAGTTCTTCAACGCCGTCTTTGGCAACATGGACGCCGTATCGGCCGTTCACAAGCAG
CACCTCCTGTCGCGGCTCAGGCACAGGCGAGACGCCCAGGGCCCGTGGATCGTCGGCTTCAGCGACATCTTTCGA
GAATGGATACGCAAGGCCAAGTCGGACTACATCGAATATGCGGCCTGCTATCCGCGGGCCAAGTATCTGCTGCAG
AAGGAGTCGGAGCGCAATGTCTTGTTCCAAAAGTTTAACGAGGAGATGCGCAAGGACAAGGCGTCTTCGAAGCAG
GACTGGACTCATTTCTTGCTTGCCCCTATCCAGCGGCTGCCGCGGTACATTCTTTTGTTGGAAACGGTGGACAAG
AACACGGTGGACGAGAGCGAGGAAAAGACGAACCTGCAGAGGGCCATCCAGGAGATCCGGACGGTGACGATTGAG
TGCGACGCCAAGGTGGCCGAGACGGAGGCTCGGGTGCACATGATGGCGTTGGACCAGATGCTCGTGCTGCGCCCT
GGCTTCCAGTCGGTGCTGAACCTTCACCACCTCGGCAGGGCCCTCATCAAGCAGGGCGAGCTGCAGAGGATGGGA
TCCAAGGGGATGCGATGGGTGGACACGCATGCCCTGCTGTTTGATCACTACCTGATCCTGTCCAAGGTAGTCTTC
ACCAAGGACGGCAGGGCGGAGAAGAAGTTTGACGTGTCGCGAGAGCCCATTCCGATGCCGCTGCTGCTTCTGGAG
AGCATGAATGACGAGCCGGTGACGAAGCAAAAGGTCATAACGGCGCCGCTGAGCCGGACCACGGCGGCCTCTGCC
TCGGGCACGCAACTCAACAAGGCGACCAGCAACGGCGGAGGCCGGCAAGCGCTCGAGCACGCGGCGACGGGGTCA
TCGATGAGCAGCCTGACGACGGTCACTACGTTTGACTCGGAGAGCAAGGTCATCTATCCGTTCCGGGTGAAGCAC
CTGGGTCACGAGGTGTACACTCTGCACGCCCCGTCGGCGCGGGACCGGCGAGACTGGTGCATGAGCATCATCGAC
GCCAAGACGAGGCACGCCGAGTCGTTGTTCTCGCAGAACGCTGAGCCGTTTCGGCTACGGGTCTTGGCCGATGCC
TCGTTCCACTACGACGCCAACTCGATCTATATGCGTGCCTCGGGCGTGCACGTCAAGGGAACGCCGCTGGACCGG
GCCATCCAGGAGCTGGAGAGCGTCATGGGCTCGTCTCAGGGCATCGCGCCCGTGTGCCGAGCGCAAGTCAACTGC
GCGGCTGGCTTCTCGGCGTTTGGAAGGCCGCTGCTGGCCATCGGGACAGACTACGGCATCTTTGTCACGGACCCG
GCCGAGCCCCGGGGATGGCGTCGGACGGTACAGACAGCGCGGGTGACGCAGATGGCGGTGCTGGAAGAGTTTGCC
GTGTGTCTGGCAATCGCAGACAAGTCGCTCGTGTCGTATCCGCTCGATGTTGTGGCGCCCAACTCGGATCTGGCA
CCGCCCATGAGCGACAGCCCGCGACGGGCACCGCAGCGGCTGGCCAAGGACGTGACGTACTTTGCGACGGCGCGG
ATGAAGGACCGGACGCTCGTCTTCTACAAGCGCAAGGAGGGCCTCCATACGTCGTTTAAGGTGCTGGAGCCCATC
CTCCACAAGGCCACGGAGAAGCGGTCGCGCTTCGGACGGCGGGCGATTGCCCGTAGCACCGACACGTTTCGCGAC
TTTGACGAGTTTTACCTGCCGACAGAGTGCTATTCGCTCAGCCTGTTCCAGACGTACATTGCCGTGGCGACGGCC
AAGGGCATCGAGATGCTCACGTTGGACAAGAAGCAGCCCATGTCGATTCCGGACCTCAAGGCGCCGGCCATTGCG
AATATTGCCGGGCGTGTCCGTGACCAGCGGCCGCTCGGCATGTTTCGACTCAACGACAGCGAGTTCATCCTGACG
TACGAGGACTGCGCCGTCTACGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACTGGCAAG
CAGAAAAAGGCCCGGAGCGCGACCATGTACGGCCAGTACCTGCTGCTCTTCAACGACGACTACGTCGAGGTGCGC
AACGCCGACAACGGCCGACTGCGGCAGATCATCGCCGGCCGCGACGTCCGCGTCATCGACTTTGGCGTCCGGGGC
CCGACGGGGGGGAACGCCTCGGCGACGCAGGCCAACGGGCACGCGCCGGGAGACGTCAGCAAGGGCACCGTCAAG
ATCTCCATGTGCCATCCCGAGCAGGCGGGGAAGCAGATTGTGCTCGAGATGCTGCTCAACGACGGACATGTGGAT
TGA
Gene >Ophun1|5526
ATGTCGTTCCGCGCCGACGATCAGCGTCGCTACGGCCACGTTCCGCCCGTCCAGTATCCCGTTCCCGGCCATCCT
CCCGACCGTCAGGCAGCGGGTCGTCGTCTGAGCTTCAACAGCGGCGACGACGCTGCCTACTACGGCCCTCAGTCG
CCCGCTGCCCCTCCTCATCATCCCTCCGCCGAGGACGAACTCTTCTTCAACCCCAGTTCCACCAGCCCTTCGGCT
TATGGCTCATCCAACAGCGCCTACCAACGCCAGTATCAGAGCACCACGCCCCGTACGCCCCCGACTCATTCCACC
TACAATCCCCAGGCCTTTTCCACCCCATCCGCCTCGGCCGCTCTGCGAAACTCCCCGTCGGCCGCTCCCCCTCAT
CAGCCGCACTCGTCGCCGCGATACTCGGGCAGCTCCTACGGCACCTCTCCTCCGGCTGGTTACGCCCCGCAGGTC
TATAATCCAGCCGCCTACGCCGACACAAACGGACATCAGCGTCAGCCTGTTCACTCCGGCTATCCTCAAGACCAA
GTCTACGCCGCCGTGCGTGGCCAGTCGCCGGCCTCGGCCTATACAGCTGCCTTTCCTCACCAGCTGCCCTCTGCC
GGCCAGTCTGTTGGCCAAGCCTTTACCTATGACCCTTCTCAGTATGCCTCGTACGGTGACGCCCAGTCGTCGGCC
TCGCACGCTTCCGTCTCCCACCTCCCGTATCCCACCACGTCGCAAATACCCGTCGGCCCCAACTACCAGGACCAG
ACCTCGTACTTTGGCCGTCCCGTTCGGTCAGACTCGCAGCAGTCTTCGCGAGCCTCTCCCTACATGCATCCGCAC
TCGCCTTCTGGTCTCCAGAGGCACCCGACCAACGCGCCCCTTCCGAGCCGGCCGATGGACGAGCCGATGGATGAG
CCTTACTGGGACGTCAATGGCCGGCTTTCGGGCAGGGAACGCAACCTGGAGCGGGTGACGCCCGAGAGCATCATG
GAGGAAATCGAGGCCGAGCTGGGCGAGACCAGCCTCCGATCCCGACGGCGCCCATCCCCGATGAACGGCCAGCCG
TCTCAAGAGCAGGCCCAGCGGGCGCCGCCTCATGTCCCACCGCACTCTCCTTCGGCGTCTCCGGGCAGAGCTCCG
GTCCACTACGATGACGAAGACGACGATGACGACGATGACGACCCCGAAGGAACCGCGGGTGTGCTGGCCATGCGA
CAGGCTGAACTGGACGAAGAGCGGTTCAGCGGCAACGCCTTCATGTACAGCGACTTTCCTGCGCCCTTGCCGGTC
CCCCCCAAAAACCCCTTGCCTCCGCCGCCCGAGCTGCAGGATGCCAGCAGCGACAGCGACTTTGGGAGCAACGTC
GACCTGGGCATCATGAGTGGTGGCCACGCCGGCGACTTGGCATATGGCGAGCATGTCGGATCCTTCTCCGGTGCC
TCCTCTTTGCCAGCAGTCTCACGGCCCTTGCCGATGCCGACTTACGGGGCCGAGAGCTACGGCGAGACGCCCTTC
AACGCCGAGATGGATTATGTCGGCACCGGCGGGTTGCGCGCCCCGAGGGCATCGCGGTTGAGCTTCGACGAAGGC
CGGGATGAGAGGGTTTCCATTCACTCGGGAGACTCGCGGCGGAGCGGCACCGAGTCGCCCGTCAAGGACGATTAC
CAGGACCTCTTTTACCATCCCGGCCTCTCCAGCAGGCCGTTGCCGGCTTTGCCTCCGGGCCCCGGCTCAGACAGC
AGCTCGATGTTGTCGGCTCACAACAGCCTCCGTTCGCAGAATCAGAACCAGCACCAGCACTCGCTGAGCGCAGAC
GCCCGCTACTACCAGGCCGACGCTCCCGAGGCCTTTTACCAGTCAACATCGCAGCAGATGCTGCAGCCGGAGAGA
TCCATCTCGCTCTCCGGTCACAGCCACACGCCGCAGGTACAGGCCCCTACGAGATCGCGGACGGATGCGACAGAG
GAGCGCAAAAAGATGAATCGGCAGCAGCAAATGGTCCTGCAGCAGGGACCGGTACTCTCGGAGCACAATGAGTCG
GGTCCCGGCCTCCCTCCCGGCGCCTTTGACAGCATCACGTTGCCGAGCGGGCGCAAGAAGAAGTTTGTGCCGTCG
AAGCTGTCGGCGTCGGACTTTCGCAAGTGCCAGGAAGCATGGGCACTCAGCGCCATCGAGGCGTGGGTGCGGCTG
ATGGGAGAAGGCGAGATTGATCTCAAAGAGAAGACGGTGGAAGAGGCGGTGACGAACCTGTTTGCCTTCAAGGTG
CCGACGATGAACGTTGCGGATGCCGAGACGCTCAGCAGCCACGTGGTCCGGCTCATGCTCGACTCTGGCCTCTTG
CTACCGGACGAGGAATGGGTCAAGTTTGGCGACGGGCATATATCCGGCATCCTCTGGCAGCTGACCGGTTCGGGC
TGCTACGCCCCCAAGCTTCACGCCTTCGAGACGAGCGGCCACTGCTACTCGCATCTGTGCACGCGTACCGTCCGC
AAGTTTGAGCTGGACGACCTGGAGTCGGACGACGCCGAGAAGAAGGAATGGCACGTCTACCACAACCTGACGCCG
GAAGAGATCAGCGCCAAGGGCGGCAAGGAGGTGGCGCGACAGAACAATCTGCACGAGATTGTCACGGGCGAGCAC
CACTACGTCAAGCAGCTGGACATCTTTCGCAACATTTACCGCGAGAGCCTGCGGAGGCGGCAGCCGCCCATCATC
CACCCGGAGAAGCAGGAAAAGTTCTTCAACGCCGTCTTTGGCAACATGGACGCCGTATCGGCCGTTCACAAGCAG
CACCTCCTGTCGCGGCTCAGGCACAGGCGAGACGCCCAGGGCCCGTGGATCGTCGGCTTCAGCGACATCTTTCGA
GAATGGATACGCAAGGCCAAGTCGGACTACATCGAATATGCGGCCTGCTATCCGCGGGCCAAGTATCTGCTGCAG
AAGGAGTCGGAGCGCAATGTCTTGTTCCAAAAGTTTAACGAGGAGATGCGCAAGGACAAGGCGTCTTCGAAGCAG
GACTGGACTCATTTCTTGCTTGCCCCTATCCAGCGGCTGCCGCGGTACATTCTTTTGTTGGAAACGGTGGACAAG
AACACGGTGGACGAGAGCGAGGAAAAGACGAACCTGCAGAGGGCCATCCAGGAGATCCGGACGGTGACGATTGAG
TGCGACGCCAAGGTGGCCGAGACGGAGGCTCGGGTGCACATGATGGCGTTGGACCAGATGCTCGTGCTGCGCCCT
GGCTTCCAGTCGGTGCTGAACCTTCACCACCTCGGCAGGGCCCTCATCAAGCAGGGCGAGCTGCAGAGGATGGGA
TCCAAGGGGATGCGATGGGTGGACACGCATGCCCTGCTGTTTGATCACTACCTGATCCTGTCCAAGGTAGTCTTC
ACCAAGGACGGCAGGGCGGAGAAGAAGTTTGACGTGTCGCGAGAGGTGAGTTGTCTGGATTAAGGCGGACGAGCT
GGAGGCTTACTGACTGCTCGACAGCCCATTCCGATGCCGCTGCTGCTTCTGGAGAGCATGAATGACGAGCCGGTG
ACGAAGCAAAAGGTCATAACGGCGCCGCTGAGCCGGACCACGGCGGCCTCTGCCTCGGGCACGCAACTCAACAAG
GCGACCAGCAACGGCGGAGGCCGGCAAGCGCTCGAGCACGCGGCGACGGGGTCATCGATGAGCAGCCTGACGACG
GTCACTACGTTTGACTCGGAGAGCAAGGTCATCTATCCGTTCCGGGTGAAGCACCTGGGTCACGAGGTGTACACT
CTGCACGCCCCGTCGGCGCGGGACCGGCGAGACTGGTGCATGAGCATCATCGACGCCAAGACGAGGCACGCCGAG
TCGTTGTTCTCGCAGAACGCTGAGCCGTTTCGGCTACGGGTCTTGGCCGATGCCTCGTTCCACTACGACGCCAAC
TCGATCTATATGCGTGCCTCGGGCGTGCACGTCAAGGGAACGCCGCTGGACCGGGCCATCCAGGAGCTGGAGAGC
GTCATGGGCTCGTCTCAGGGCATCGCGCCCGTGTGCCGAGCGCAAGTCAACTGCGCGGCTGGCTTCTCGGCGTTT
GGAAGGCCGCTGCTGGCCATCGGGACAGACTACGGCATCTTTGTCACGGACCCGGCCGAGCCCCGGGGATGGCGT
CGGGTGAGTGGGAGCTCCTATTCAGCCCCTGTTCAGCCCCTATCCAGGAAGCAGTTGCTGACGCCGTTTCGACAC
ACCAGACGGTACAGACAGCGCGGGTGACGCAGATGGCGGTGCTGGAAGAGTTTGCCGTGTGTCTGGCAATCGCAG
ACAAGTCGCTCGTGTCGTATCCGCTCGATGTTGTGGCGCCCAACTCGGATCTGGCACCGCCCATGAGCGACAGCC
CGCGACGGGCACCGCAGCGGCTGGCCAAGGACGTGACGTACTTTGCGACGGCGCGGATGAAGGACCGGACGCTCG
TCTTCTACAAGCGCAAGGAGGGCCTCCATACGTCGTTTAAGGTGCTGGAGCCCATCCTCCACAAGGCCACGGAGA
AGCGGTCGCGCTTCGGACGGCGGGCGATTGCCCGTAGCACCGACACGTTTCGCGACTTTGACGAGTTTTACCTGC
CGACAGAGTGCTATTCGCTCAGCCTGTTCCAGACGTACATTGCCGTGGCGACGGCCAAGGGCATCGAGATGCTCA
CGTTGGACAAGAAGCAGCCCATGTCGATTCCGGACCTCAAGGCGCCGGCCATTGCGAATATTGCCGGGCGTGTCC
GTGACCAGCGGCCGCTCGGCATGTTTCGACTCAACGACAGCGAGTTCATCCTGACGTACGAGGACTGCGCCGTCT
ACGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACTGGCAAGCAGAAAAAGGCCCGGAGCG
CGACCATGTACGGCCAGTACCTGCTGCTCTTCAACGACGACTACGTCGAGGTGCGCAACGCCGACAACGGCCGAC
TGCGGCAGATCATCGCCGGCCGCGACGTCCGCGTCATCGACTTTGGCGTCCGGGGCCCGACGGGGGGGAACGCCT
CGGCGACGCAGGCCAACGGGCACGCGCCGGGAGACGTCAGCAAGGGCACCGTCAAGATCTCCATGTGCCATCCCG
AGCAGGCGGGGAAGCAGATTGTGCTCGAGATGCTGCTCAACGACGGACATGTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail