Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5523
Gene name
LocationContig_55:34096..36757
Strand-
Gene length (bp)2661
Transcript length (bp)2661
Coding sequence length (bp)2661
Protein length (aa) 887

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00565 SNase Staphylococcal nuclease homologue 9.0E-05 33 141
PF00565 SNase Staphylococcal nuclease homologue 4.5E-13 198 303
PF00565 SNase Staphylococcal nuclease homologue 4.1E-16 342 451
PF00565 SNase Staphylococcal nuclease homologue 2.1E-19 510 615
PF00567 TUDOR Tudor domain 3.9E-22 645 770

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U7|SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snd1 PE=1 SV=1 1 885 4.0E-165
sp|Q863B3|SND1_BOVIN Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus GN=SND1 PE=1 SV=1 7 886 4.0E-127
sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens GN=SND1 PE=1 SV=1 7 886 1.0E-126
sp|Q5REU4|SND1_PONAB Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii GN=SND1 PE=2 SV=1 7 886 2.0E-126
sp|Q66X93|SND1_RAT Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus GN=Snd1 PE=1 SV=1 7 886 2.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U7|SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snd1 PE=1 SV=1 1 885 4.0E-165
sp|Q863B3|SND1_BOVIN Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus GN=SND1 PE=1 SV=1 7 886 4.0E-127
sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens GN=SND1 PE=1 SV=1 7 886 1.0E-126
sp|Q5REU4|SND1_PONAB Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii GN=SND1 PE=2 SV=1 7 886 2.0E-126
sp|Q66X93|SND1_RAT Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus GN=Snd1 PE=1 SV=1 7 886 2.0E-125
sp|Q78PY7|SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus GN=Snd1 PE=1 SV=1 7 886 2.0E-125
sp|Q7ZT42|SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio GN=snd1 PE=2 SV=1 7 785 9.0E-116
sp|Q58EK5|TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio GN=tdrd1 PE=1 SV=2 673 805 1.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1299
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3576
Ophiocordyceps australis map64 (Brazil) OphauB2|3111
Ophiocordyceps camponoti-floridani Ophcf2|00832
Ophiocordyceps camponoti-rufipedis Ophun1|5523 (this protein)
Ophiocordyceps kimflemingae Ophio5|4723
Ophiocordyceps subramaniannii Hirsu2|10605

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5523
MAKVFIGNVKSVLSGDTLVLTSPNNPAAERIFSLAYVSAPHLRRDGDEPFAFHSREHLRNLVVGKPVQCSVLYTI
PSTSREFGTAKLKDGTELPDELVKAGWLKVREDAGRKEESDENTERVEKLRSLESQARADSKGLWAGSGGLIDVQ
NDLGGPDFIKEWKGKTVDGIVERVLSGDRLVVRLLLSDKKHVQPMTLLAGIRTPATERTLPSTGAVQPAEEYGNE
ARQFVETRLLQRQVKVDIVGVSPQGQLVATVMHPRGNIAEFLLSEGLARCNDFHSTMLADKMALLRAAEKQAQIN
KLRMHKHHVAKAEVGNQEMTVTKIIGADTVLVKNKAGTVEKRISFSSVRGPRAGEPSESPFRDEAKEFLRQKLIG
KHVKISVDGTKPAADGFEARDVATVTDKGKNVGLMLVEAGWASVIRHRKDDTDRASNYDELLAAQEKAKEEKKGM
WCGKPQKAKQYVDLSENTQKAKIMLATLQRQKKVPAIVDFCKAGSRFTILIPRESVKLTMVLGGIRAPRAPRADG
EGGEPFGKEALDLANRRCNQRDCEVDIHDMDKVGGFIGDLFINRESFAKALVEEGLASVHAYSAEKSGNSAELFA
AESRAKEGKKGLWHDYDASQEENGQEAEAADKKPDETEVKMDKKPTDYRDVVITNVDANGKIKVQEIGKGTAALE
KMMNDFRKFHLDSRNNQPLAAAPKTGEFVSAKFSADGQWYRARVRANDRTAKQSEVVFVDYGNSEKVAWSSLRPL
DQGQFGTAKLKAQAMDASLSFVQLPGGQDYLHDAMGFIADLTEGKRLVGSFDLVDAKEGISYLTLYDAKANGDLP
GLNDSINKEIVANGYGMVPRKLRAWERSKAFEPYLEHLRQVEAQAKQERRGMWEYGDITED*
Coding >Ophun1|5523
ATGGCCAAGGTCTTCATCGGCAACGTCAAGAGCGTCCTGAGCGGCGACACGCTAGTCCTGACGAGTCCCAATAAC
CCGGCCGCCGAACGCATCTTCTCCCTGGCCTACGTCTCGGCTCCTCACCTCCGAAGAGACGGCGACGAGCCCTTT
GCTTTCCATTCCCGCGAGCATCTACGCAACCTCGTCGTCGGCAAGCCCGTACAATGCTCCGTCCTCTACACCATC
CCCTCGACCTCGCGCGAGTTCGGCACCGCCAAGCTCAAGGACGGCACCGAGCTGCCAGATGAACTGGTAAAGGCC
GGCTGGCTCAAGGTCCGTGAAGACGCCGGCCGCAAGGAGGAGTCGGACGAGAACACGGAGAGGGTCGAGAAGCTC
CGCTCTCTCGAGTCCCAGGCTCGCGCCGACAGCAAGGGTCTGTGGGCCGGCAGCGGCGGCCTCATCGATGTCCAG
AACGATCTCGGCGGTCCCGACTTCATCAAGGAGTGGAAGGGCAAGACGGTCGACGGCATCGTCGAGCGCGTCCTC
AGTGGCGACCGTCTCGTCGTCCGCCTGCTGCTCTCCGACAAGAAGCACGTCCAGCCCATGACGCTTCTGGCCGGC
ATCCGCACCCCGGCCACGGAGAGGACGCTGCCGTCGACGGGAGCCGTGCAGCCGGCCGAGGAGTACGGCAACGAA
GCCCGTCAATTCGTCGAGACGCGTCTGCTGCAGCGCCAGGTCAAGGTCGACATCGTCGGTGTCAGCCCGCAGGGC
CAACTGGTCGCCACCGTCATGCACCCGCGAGGCAACATTGCCGAATTCCTTCTATCGGAAGGTCTCGCCAGATGC
AACGACTTTCATTCCACCATGCTGGCCGACAAGATGGCCTTGCTTCGTGCCGCCGAGAAGCAGGCCCAGATCAAC
AAGCTCCGCATGCACAAGCACCACGTCGCCAAGGCCGAGGTCGGCAACCAGGAGATGACGGTGACCAAGATCATC
GGCGCCGATACCGTCCTCGTCAAGAACAAGGCCGGCACCGTTGAGAAGAGAATCAGCTTCAGCAGCGTGCGCGGG
CCCCGGGCCGGAGAGCCGTCGGAAAGCCCGTTCCGCGACGAGGCCAAGGAATTCCTGCGCCAGAAGCTCATCGGA
AAGCACGTCAAGATCAGCGTCGACGGCACCAAGCCCGCTGCCGATGGCTTCGAGGCCAGGGACGTCGCCACCGTG
ACGGACAAGGGCAAGAATGTCGGCCTGATGCTGGTCGAGGCTGGCTGGGCGTCCGTCATCCGCCACCGCAAGGAC
GACACCGACAGGGCCTCCAACTACGACGAGCTGCTTGCCGCGCAGGAAAAGGCCAAGGAAGAGAAGAAGGGCATG
TGGTGCGGGAAGCCGCAAAAGGCCAAGCAGTACGTCGACTTGTCGGAAAACACGCAAAAGGCCAAGATCATGCTC
GCCACGCTGCAGCGGCAGAAAAAGGTGCCCGCCATCGTCGACTTTTGCAAGGCCGGCTCTCGCTTCACCATCCTG
ATCCCCCGAGAGTCGGTCAAACTAACCATGGTCCTCGGCGGCATCCGTGCTCCCCGCGCTCCCCGGGCCGACGGC
GAGGGCGGCGAGCCCTTTGGCAAGGAGGCTCTCGATCTAGCCAACCGCCGGTGCAACCAGCGGGACTGCGAGGTG
GATATTCACGACATGGACAAGGTCGGAGGCTTCATCGGCGACCTCTTTATCAACCGTGAGAGCTTCGCCAAGGCG
CTGGTCGAGGAGGGGCTGGCGTCGGTTCACGCTTACTCGGCCGAGAAGTCGGGCAATTCGGCCGAGCTGTTTGCG
GCCGAGTCGCGAGCGAAGGAGGGCAAGAAGGGGTTGTGGCACGACTATGACGCCTCGCAGGAGGAGAACGGGCAA
GAGGCCGAGGCGGCCGATAAGAAGCCCGATGAGACGGAGGTGAAGATGGACAAGAAACCGACCGATTACCGCGAC
GTCGTCATCACCAACGTCGACGCCAACGGCAAGATCAAGGTCCAGGAGATTGGCAAGGGCACGGCGGCGCTGGAG
AAGATGATGAACGACTTTCGCAAGTTCCACCTCGACTCGCGGAACAACCAGCCGCTGGCGGCGGCGCCCAAGACG
GGCGAGTTTGTGTCGGCCAAGTTCTCGGCCGACGGACAGTGGTACCGGGCGCGCGTGCGGGCCAACGACCGGACG
GCCAAGCAGTCCGAAGTCGTCTTCGTCGACTACGGCAACAGCGAAAAGGTGGCTTGGAGCAGCCTCCGCCCGTTG
GACCAGGGCCAATTCGGCACTGCCAAGCTCAAGGCGCAGGCCATGGACGCGTCGCTCTCCTTCGTCCAGCTGCCG
GGCGGGCAGGACTACCTGCACGACGCCATGGGCTTCATCGCCGACCTTACCGAGGGTAAGCGGCTGGTGGGCAGC
TTCGACCTGGTCGACGCCAAGGAGGGCATCAGCTACCTGACTCTCTACGACGCAAAAGCCAACGGCGACCTCCCG
GGCCTCAACGACTCCATCAACAAGGAGATTGTCGCCAACGGCTACGGCATGGTACCCAGGAAGCTCCGCGCCTGG
GAGCGCAGCAAGGCCTTTGAGCCCTACCTCGAGCACCTGCGCCAGGTCGAGGCCCAGGCCAAGCAGGAACGCAGG
GGGATGTGGGAGTACGGCGACATCACCGAGGATTAA
Transcript >Ophun1|5523
ATGGCCAAGGTCTTCATCGGCAACGTCAAGAGCGTCCTGAGCGGCGACACGCTAGTCCTGACGAGTCCCAATAAC
CCGGCCGCCGAACGCATCTTCTCCCTGGCCTACGTCTCGGCTCCTCACCTCCGAAGAGACGGCGACGAGCCCTTT
GCTTTCCATTCCCGCGAGCATCTACGCAACCTCGTCGTCGGCAAGCCCGTACAATGCTCCGTCCTCTACACCATC
CCCTCGACCTCGCGCGAGTTCGGCACCGCCAAGCTCAAGGACGGCACCGAGCTGCCAGATGAACTGGTAAAGGCC
GGCTGGCTCAAGGTCCGTGAAGACGCCGGCCGCAAGGAGGAGTCGGACGAGAACACGGAGAGGGTCGAGAAGCTC
CGCTCTCTCGAGTCCCAGGCTCGCGCCGACAGCAAGGGTCTGTGGGCCGGCAGCGGCGGCCTCATCGATGTCCAG
AACGATCTCGGCGGTCCCGACTTCATCAAGGAGTGGAAGGGCAAGACGGTCGACGGCATCGTCGAGCGCGTCCTC
AGTGGCGACCGTCTCGTCGTCCGCCTGCTGCTCTCCGACAAGAAGCACGTCCAGCCCATGACGCTTCTGGCCGGC
ATCCGCACCCCGGCCACGGAGAGGACGCTGCCGTCGACGGGAGCCGTGCAGCCGGCCGAGGAGTACGGCAACGAA
GCCCGTCAATTCGTCGAGACGCGTCTGCTGCAGCGCCAGGTCAAGGTCGACATCGTCGGTGTCAGCCCGCAGGGC
CAACTGGTCGCCACCGTCATGCACCCGCGAGGCAACATTGCCGAATTCCTTCTATCGGAAGGTCTCGCCAGATGC
AACGACTTTCATTCCACCATGCTGGCCGACAAGATGGCCTTGCTTCGTGCCGCCGAGAAGCAGGCCCAGATCAAC
AAGCTCCGCATGCACAAGCACCACGTCGCCAAGGCCGAGGTCGGCAACCAGGAGATGACGGTGACCAAGATCATC
GGCGCCGATACCGTCCTCGTCAAGAACAAGGCCGGCACCGTTGAGAAGAGAATCAGCTTCAGCAGCGTGCGCGGG
CCCCGGGCCGGAGAGCCGTCGGAAAGCCCGTTCCGCGACGAGGCCAAGGAATTCCTGCGCCAGAAGCTCATCGGA
AAGCACGTCAAGATCAGCGTCGACGGCACCAAGCCCGCTGCCGATGGCTTCGAGGCCAGGGACGTCGCCACCGTG
ACGGACAAGGGCAAGAATGTCGGCCTGATGCTGGTCGAGGCTGGCTGGGCGTCCGTCATCCGCCACCGCAAGGAC
GACACCGACAGGGCCTCCAACTACGACGAGCTGCTTGCCGCGCAGGAAAAGGCCAAGGAAGAGAAGAAGGGCATG
TGGTGCGGGAAGCCGCAAAAGGCCAAGCAGTACGTCGACTTGTCGGAAAACACGCAAAAGGCCAAGATCATGCTC
GCCACGCTGCAGCGGCAGAAAAAGGTGCCCGCCATCGTCGACTTTTGCAAGGCCGGCTCTCGCTTCACCATCCTG
ATCCCCCGAGAGTCGGTCAAACTAACCATGGTCCTCGGCGGCATCCGTGCTCCCCGCGCTCCCCGGGCCGACGGC
GAGGGCGGCGAGCCCTTTGGCAAGGAGGCTCTCGATCTAGCCAACCGCCGGTGCAACCAGCGGGACTGCGAGGTG
GATATTCACGACATGGACAAGGTCGGAGGCTTCATCGGCGACCTCTTTATCAACCGTGAGAGCTTCGCCAAGGCG
CTGGTCGAGGAGGGGCTGGCGTCGGTTCACGCTTACTCGGCCGAGAAGTCGGGCAATTCGGCCGAGCTGTTTGCG
GCCGAGTCGCGAGCGAAGGAGGGCAAGAAGGGGTTGTGGCACGACTATGACGCCTCGCAGGAGGAGAACGGGCAA
GAGGCCGAGGCGGCCGATAAGAAGCCCGATGAGACGGAGGTGAAGATGGACAAGAAACCGACCGATTACCGCGAC
GTCGTCATCACCAACGTCGACGCCAACGGCAAGATCAAGGTCCAGGAGATTGGCAAGGGCACGGCGGCGCTGGAG
AAGATGATGAACGACTTTCGCAAGTTCCACCTCGACTCGCGGAACAACCAGCCGCTGGCGGCGGCGCCCAAGACG
GGCGAGTTTGTGTCGGCCAAGTTCTCGGCCGACGGACAGTGGTACCGGGCGCGCGTGCGGGCCAACGACCGGACG
GCCAAGCAGTCCGAAGTCGTCTTCGTCGACTACGGCAACAGCGAAAAGGTGGCTTGGAGCAGCCTCCGCCCGTTG
GACCAGGGCCAATTCGGCACTGCCAAGCTCAAGGCGCAGGCCATGGACGCGTCGCTCTCCTTCGTCCAGCTGCCG
GGCGGGCAGGACTACCTGCACGACGCCATGGGCTTCATCGCCGACCTTACCGAGGGTAAGCGGCTGGTGGGCAGC
TTCGACCTGGTCGACGCCAAGGAGGGCATCAGCTACCTGACTCTCTACGACGCAAAAGCCAACGGCGACCTCCCG
GGCCTCAACGACTCCATCAACAAGGAGATTGTCGCCAACGGCTACGGCATGGTACCCAGGAAGCTCCGCGCCTGG
GAGCGCAGCAAGGCCTTTGAGCCCTACCTCGAGCACCTGCGCCAGGTCGAGGCCCAGGCCAAGCAGGAACGCAGG
GGGATGTGGGAGTACGGCGACATCACCGAGGATTAA
Gene >Ophun1|5523
ATGGCCAAGGTCTTCATCGGCAACGTCAAGAGCGTCCTGAGCGGCGACACGCTAGTCCTGACGAGTCCCAATAAC
CCGGCCGCCGAACGCATCTTCTCCCTGGCCTACGTCTCGGCTCCTCACCTCCGAAGAGACGGCGACGAGCCCTTT
GCTTTCCATTCCCGCGAGCATCTACGCAACCTCGTCGTCGGCAAGCCCGTACAATGCTCCGTCCTCTACACCATC
CCCTCGACCTCGCGCGAGTTCGGCACCGCCAAGCTCAAGGACGGCACCGAGCTGCCAGATGAACTGGTAAAGGCC
GGCTGGCTCAAGGTCCGTGAAGACGCCGGCCGCAAGGAGGAGTCGGACGAGAACACGGAGAGGGTCGAGAAGCTC
CGCTCTCTCGAGTCCCAGGCTCGCGCCGACAGCAAGGGTCTGTGGGCCGGCAGCGGCGGCCTCATCGATGTCCAG
AACGATCTCGGCGGTCCCGACTTCATCAAGGAGTGGAAGGGCAAGACGGTCGACGGCATCGTCGAGCGCGTCCTC
AGTGGCGACCGTCTCGTCGTCCGCCTGCTGCTCTCCGACAAGAAGCACGTCCAGCCCATGACGCTTCTGGCCGGC
ATCCGCACCCCGGCCACGGAGAGGACGCTGCCGTCGACGGGAGCCGTGCAGCCGGCCGAGGAGTACGGCAACGAA
GCCCGTCAATTCGTCGAGACGCGTCTGCTGCAGCGCCAGGTCAAGGTCGACATCGTCGGTGTCAGCCCGCAGGGC
CAACTGGTCGCCACCGTCATGCACCCGCGAGGCAACATTGCCGAATTCCTTCTATCGGAAGGTCTCGCCAGATGC
AACGACTTTCATTCCACCATGCTGGCCGACAAGATGGCCTTGCTTCGTGCCGCCGAGAAGCAGGCCCAGATCAAC
AAGCTCCGCATGCACAAGCACCACGTCGCCAAGGCCGAGGTCGGCAACCAGGAGATGACGGTGACCAAGATCATC
GGCGCCGATACCGTCCTCGTCAAGAACAAGGCCGGCACCGTTGAGAAGAGAATCAGCTTCAGCAGCGTGCGCGGG
CCCCGGGCCGGAGAGCCGTCGGAAAGCCCGTTCCGCGACGAGGCCAAGGAATTCCTGCGCCAGAAGCTCATCGGA
AAGCACGTCAAGATCAGCGTCGACGGCACCAAGCCCGCTGCCGATGGCTTCGAGGCCAGGGACGTCGCCACCGTG
ACGGACAAGGGCAAGAATGTCGGCCTGATGCTGGTCGAGGCTGGCTGGGCGTCCGTCATCCGCCACCGCAAGGAC
GACACCGACAGGGCCTCCAACTACGACGAGCTGCTTGCCGCGCAGGAAAAGGCCAAGGAAGAGAAGAAGGGCATG
TGGTGCGGGAAGCCGCAAAAGGCCAAGCAGTACGTCGACTTGTCGGAAAACACGCAAAAGGCCAAGATCATGCTC
GCCACGCTGCAGCGGCAGAAAAAGGTGCCCGCCATCGTCGACTTTTGCAAGGCCGGCTCTCGCTTCACCATCCTG
ATCCCCCGAGAGTCGGTCAAACTAACCATGGTCCTCGGCGGCATCCGTGCTCCCCGCGCTCCCCGGGCCGACGGC
GAGGGCGGCGAGCCCTTTGGCAAGGAGGCTCTCGATCTAGCCAACCGCCGGTGCAACCAGCGGGACTGCGAGGTG
GATATTCACGACATGGACAAGGTCGGAGGCTTCATCGGCGACCTCTTTATCAACCGTGAGAGCTTCGCCAAGGCG
CTGGTCGAGGAGGGGCTGGCGTCGGTTCACGCTTACTCGGCCGAGAAGTCGGGCAATTCGGCCGAGCTGTTTGCG
GCCGAGTCGCGAGCGAAGGAGGGCAAGAAGGGGTTGTGGCACGACTATGACGCCTCGCAGGAGGAGAACGGGCAA
GAGGCCGAGGCGGCCGATAAGAAGCCCGATGAGACGGAGGTGAAGATGGACAAGAAACCGACCGATTACCGCGAC
GTCGTCATCACCAACGTCGACGCCAACGGCAAGATCAAGGTCCAGGAGATTGGCAAGGGCACGGCGGCGCTGGAG
AAGATGATGAACGACTTTCGCAAGTTCCACCTCGACTCGCGGAACAACCAGCCGCTGGCGGCGGCGCCCAAGACG
GGCGAGTTTGTGTCGGCCAAGTTCTCGGCCGACGGACAGTGGTACCGGGCGCGCGTGCGGGCCAACGACCGGACG
GCCAAGCAGTCCGAAGTCGTCTTCGTCGACTACGGCAACAGCGAAAAGGTGGCTTGGAGCAGCCTCCGCCCGTTG
GACCAGGGCCAATTCGGCACTGCCAAGCTCAAGGCGCAGGCCATGGACGCGTCGCTCTCCTTCGTCCAGCTGCCG
GGCGGGCAGGACTACCTGCACGACGCCATGGGCTTCATCGCCGACCTTACCGAGGGTAAGCGGCTGGTGGGCAGC
TTCGACCTGGTCGACGCCAAGGAGGGCATCAGCTACCTGACTCTCTACGACGCAAAAGCCAACGGCGACCTCCCG
GGCCTCAACGACTCCATCAACAAGGAGATTGTCGCCAACGGCTACGGCATGGTACCCAGGAAGCTCCGCGCCTGG
GAGCGCAGCAAGGCCTTTGAGCCCTACCTCGAGCACCTGCGCCAGGTCGAGGCCCAGGCCAAGCAGGAACGCAGG
GGGATGTGGGAGTACGGCGACATCACCGAGGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail