Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5521
Gene name
LocationContig_55:24884..31183
Strand-
Gene length (bp)6299
Transcript length (bp)5970
Coding sequence length (bp)5970
Protein length (aa) 1990

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 3.9E-48 1679 1919
PF02259 FAT FAT domain 1.5E-38 1101 1440
PF08064 UME UME (NUC010) domain 3.7E-23 461 557
PF02260 FATC FATC domain 2.7E-15 1958 1989

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 574 1989 0.0E+00
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 113 1989 0.0E+00
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 571 1989 0.0E+00
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 178 1989 0.0E+00
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 53 1988 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 574 1989 0.0E+00
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 113 1989 0.0E+00
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 571 1989 0.0E+00
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 178 1989 0.0E+00
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 53 1988 0.0E+00
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 571 1989 0.0E+00
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 172 1988 5.0E-175
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 444 1985 1.0E-168
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 444 1985 2.0E-168
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 461 1989 1.0E-166
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 158 1988 1.0E-165
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 213 1988 3.0E-156
sp|Q9VXG8|ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster GN=mei-41 PE=1 SV=2 652 1989 3.0E-149
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 1011 1986 2.0E-131
sp|Q8SSE7|ATR_ENCCU Probable serine/threonine-protein kinase MEC1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MEC1 PE=3 SV=2 1417 1989 2.0E-69
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 1002 1985 2.0E-63
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 1393 1989 3.0E-59
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 1642 1988 3.0E-58
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 1642 1988 3.0E-58
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 1642 1988 4.0E-58
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 1417 1985 1.0E-57
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 1402 1989 3.0E-57
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 1417 1985 4.0E-57
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 1642 1988 1.0E-56
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 1642 1988 4.0E-56
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 970 1988 4.0E-55
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 1410 1988 2.0E-54
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 1642 1988 1.0E-53
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 1643 1988 2.0E-53
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 1236 1988 2.0E-53
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 1485 1988 3.0E-52
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 1393 1989 3.0E-52
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 1417 1988 4.0E-52
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 1393 1989 4.0E-52
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 1474 1988 5.0E-51
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 1643 1988 9.0E-51
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 1657 1988 1.0E-50
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 1643 1988 2.0E-50
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 1411 1988 5.0E-50
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 1645 1918 2.0E-49
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 1645 1918 3.0E-48
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 1386 1988 4.0E-47
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 1386 1988 3.0E-45
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 1642 1918 3.0E-45
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 1654 1988 5.0E-45
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 1659 1988 6.0E-45
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 978 1985 1.0E-44
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 1642 1918 5.0E-44
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 1642 1918 1.0E-43
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 1610 1988 2.0E-43
sp|Q70PP2|SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster GN=nonC PE=1 SV=2 1644 1918 1.0E-42
sp|Q61CW2|SMG1_CAEBR Serine/threonine-protein kinase smg-1 OS=Caenorhabditis briggsae GN=smg-1 PE=3 SV=3 1641 1949 1.0E-38
sp|O01510|SMG1_CAEEL Serine/threonine-protein kinase smg-1 OS=Caenorhabditis elegans GN=smg-1 PE=1 SV=3 1641 1941 3.0E-37
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 1646 1989 5.0E-32
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 1646 1989 9.0E-32
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 1648 1989 1.0E-31
sp|Q54UC0|PRKDC_DICDI DNA-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=dnapkcs PE=3 SV=2 1646 1921 2.0E-31
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 1646 1989 2.0E-29
sp|Q9N3Q4|ATM_CAEEL Serine/threonine-protein kinase ATM OS=Caenorhabditis elegans GN=atm-1 PE=3 SV=3 1628 1989 2.0E-29
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1646 1989 4.0E-29
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 1758 1926 3.0E-25
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 970 1575 1.0E-19
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 965 1554 1.0E-15
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 965 1554 4.0E-15
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 961 1572 3.0E-14
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 965 1389 4.0E-14
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 1643 1754 2.0E-12
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 959 1558 4.0E-12
sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 OS=Drosophila melanogaster GN=Nipped-A PE=1 SV=3 1665 1989 3.0E-11
sp|P48736|PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens GN=PIK3CG PE=1 SV=3 1652 1881 7.0E-11
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 1665 1989 1.0E-10
sp|O02697|PK3CG_PIG Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Sus scrofa GN=PIK3CG PE=1 SV=2 1652 1881 2.0E-10
sp|Q9JHG7|PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus GN=Pik3cg PE=1 SV=2 1652 1881 2.0E-10
sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus GN=Trrap PE=1 SV=2 1665 1989 3.0E-10
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 961 1325 5.0E-10
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 961 1545 6.0E-10
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 1634 1989 2.0E-09
sp|Q94125|AGE1_CAEEL Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis elegans GN=age-1 PE=1 SV=6 1652 1877 1.0E-08
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 961 1531 2.0E-08
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 1645 1908 3.0E-07
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 1645 1908 4.0E-07
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 970 1558 5.0E-07
sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1 1665 1989 6.0E-07
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 870 1310 2.0E-06
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 1642 1985 2.0E-06
sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 1679 1908 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0004674 protein serine/threonine kinase activity Yes
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016301 kinase activity No
GO:0004672 protein kinase activity No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3902
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2955
Ophiocordyceps australis map64 (Brazil) OphauB2|3121
Ophiocordyceps camponoti-floridani Ophcf2|00833
Ophiocordyceps camponoti-rufipedis Ophun1|5521 (this protein)
Ophiocordyceps kimflemingae Ophio5|6075
Ophiocordyceps subramaniannii Hirsu2|7775

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5521
MASLSSLVVDGAKRRKLSSKDSPSSMLEAIYEALQVKETGDDDVVVFEQLFLTGFETASEDRQCLAVELLSRICC
AADESFSMDPEARCLICEGARDSGALRPSSSKSEARLVFCKLIRLPKFLESQRPRVVAMIGLRRLVHHCEDGDFL
DLERSGFGDVLIPGPGQWCLQSLNSSLRELRVAAGRTLPTFMPQKPTPVLDEDLLHRNRKCSIAVLKKTSDQHQP
RLVETRIMAWAQLGRVATEDELNLVLIKLLEYLGSSNGLVSAFAFNELLRLAESRSITPRRLFEPFWKNMAYMAT
KNMVQRPQQSRAIAELLQISVNELLLLIQSHALPWLVLDRQVDVIQKIAEARKEKEPWRPLMDNSNLAATLALLL
VQDADNMESFTLSRLNDVSPHFHSLTLLDLFQADPVSIALELLRFAAGADAARQQVIHKALHLLATTILRNNKDT
KVKKSNVIGRFLQSHVLGLMAKLTDVINDSVSTHPPVLEQRSCVRTLEELIKVSDEFQISACLLSAISQDALREA
SLSCWVALLANFEEEDVEMLIEPTFFIVRRYWAVFNRGTRRAAQEMLDFLLDKHAPIIMSYINKIPSLSPIAELA
DVESRLSALRPALATDEALRAFAERVAHHNSGVVHQALTELVPYLRDNQSALYTSAVSQRPDSAVTSVLRALLDC
ASKYNGVQLDMSRLCVECVGLIGCLDSNRIESVREHRSIVVLDNFEGVGEATDFGLFLLQEVLVPSFLSATDTKL
QGFLSFAMQELLIRCDIKAACAMQNTGMRGGNDVYRKWIALPEYTREIVTPFLTSRYMVERMEKVIVEYPIFHLG
KPYGNWLRLFVVDLLRNGQNEHADTLFEPLTRVIRVKDLSTAEFLLPYLVLHVLVGPRSSKEDRERVVGELLVVL
RYNPAETASYLEKEEMKKFCHAVFRVIDYAMRWIQAKRSKGRLSSVDKENLSRIQGILDEIPAELIAQRALECNE
YARALFHLEQHAQKLELKSEREPDDRIKLLERLQHIYANIDEPDGLEGISAHLPALDIKQQILTHKKAGRWTAAQ
TWYEMELAEKPDNADLQIELLRCFQQAGQHTRLLNYVESLRTEGSNNKVTPFAVEAAWVTGQWESLSKFTGRFHG
DVVQDFNMSMATLLDALHNKSSSDVLSQIVGSAREKIASEMTASATMSLQAAHQLLLRCHVLTDLEIIVNLKPGD
EEERRKTKSLLDGRLEVIGAYVNDKQYLLGIRRAAMELLRPSYTDADVSSLWVASARLARKTGSLHQSFNAVLQA
SRLGDDAATIENAKLLWRDSHHRQAIQMLQGAIERNNLTTQGGTASSVNTNVAASTKLTLPQKLVAARAQLLLAK
WLDAAGQSHASALREKYQQPPRTHHAWEKGHFYLGRHYKKIFDSERPLKVSDQSENYITGEVTRLVIENYLRSLN
VGTKYLYQTLPRVLTLWLEMGTLPDKPLEGKASLSRDTHRKRVEQLNLLHAFLDRYIHRLPAYVFYTALPQIVAR
IAHPNVSVFERLTRIIVKVVEAYPRQALWSLIGIMTSKQVTERKARGTQILQALRTVSKRVEGTSYDLKQLLRAG
EKLADQLLIACNNGDFSGNKSVQASLSRDLRFQHKCTPCPLVVPVESSLNATLPAVSEHVKKHTAFSRDVVTIDC
FLDEVLVLSSLAKPRRLTARGSDGKCYMLLIKPKDDLRTDQRLMEFNGIINRALKHDAESSRRQLYIRTYAVVPL
NEECGVIEWVPGIRTMRDILLNLYASRRIQPDYAALKSLMEEASTSEAKVRIFTDDVLGRFPAVLPVWFLQQFPS
PSAWFTARLRYTRSCAVMSMVGTILGLGDRHGENVTLEEGNGGVFHVDFNCLFDKGLTFQKPERVPFRLTHNMVA
AMGVYGYEGPFRKSSELTLSMLRQQEETLMAILEAFIYDPTLDLQKEKRHSRRGDSGVKLQPQSVVDSIRRKVRG
LLPNESIPLSVEGQVEELIKQAVDARNLTAMYIGWCPFL*
Coding >Ophun1|5521
ATGGCTTCACTTAGTAGCCTGGTCGTTGACGGCGCAAAGAGGAGAAAGCTTTCCAGCAAAGATTCGCCGTCTTCT
ATGTTGGAGGCCATCTACGAAGCCCTTCAAGTCAAAGAGACTGGAGATGACGATGTCGTCGTGTTCGAGCAACTA
TTCTTAACCGGGTTCGAGACAGCTTCCGAAGATCGTCAATGTCTTGCCGTTGAGCTCTTATCTAGAATATGCTGT
GCCGCAGACGAGTCCTTCTCGATGGATCCCGAAGCCCGATGTCTCATCTGCGAGGGCGCCCGTGACTCTGGCGCA
CTTCGACCTTCCAGCTCCAAAAGCGAGGCCCGACTAGTATTTTGCAAGCTCATCAGGCTGCCCAAGTTTCTCGAG
TCTCAGAGGCCCAGGGTTGTCGCCATGATTGGGCTGAGGAGGCTTGTACATCATTGTGAAGACGGTGATTTCCTG
GATCTAGAACGGTCAGGGTTCGGTGATGTTCTCATTCCAGGACCCGGACAATGGTGTCTCCAGTCGCTCAACAGC
TCTCTGCGGGAGCTTCGAGTCGCTGCCGGGAGAACGTTGCCTACCTTTATGCCTCAGAAGCCCACGCCCGTTTTG
GACGAGGACTTGCTGCACCGAAATCGCAAATGCTCGATCGCGGTGCTCAAGAAGACGTCGGACCAGCATCAACCA
CGTCTAGTGGAAACTCGCATCATGGCCTGGGCGCAACTGGGCCGCGTGGCCACGGAAGATGAGCTGAACCTGGTC
CTCATCAAGCTGCTAGAGTATCTGGGCAGCAGCAACGGCCTCGTCTCGGCTTTCGCGTTCAATGAGCTCCTGAGA
CTCGCCGAGTCTCGTTCGATAACGCCGAGACGTCTGTTCGAACCCTTTTGGAAGAACATGGCTTATATGGCTACC
AAGAACATGGTCCAGCGGCCGCAGCAGAGCCGGGCGATTGCAGAGCTTCTTCAAATCTCCGTCAACGAGCTGCTC
CTCCTGATACAGTCACACGCACTGCCGTGGCTCGTTCTCGACAGACAAGTAGATGTCATCCAGAAGATAGCAGAG
GCCCGGAAAGAAAAGGAGCCTTGGCGCCCACTCATGGACAACTCCAACTTGGCTGCTACTCTGGCATTGCTCCTT
GTTCAGGACGCTGACAACATGGAATCGTTTACGCTATCCCGCCTAAACGATGTTTCTCCACACTTTCACTCGCTC
ACTCTCCTTGATCTCTTCCAAGCCGATCCGGTCTCGATCGCTCTAGAGCTCTTGAGGTTCGCGGCCGGTGCCGAC
GCGGCGCGGCAGCAAGTGATCCACAAGGCTTTGCATCTCCTGGCGACAACTATTCTCAGAAACAACAAGGATACC
AAAGTCAAGAAGAGCAACGTCATCGGGCGCTTTCTTCAATCTCACGTTCTCGGCCTCATGGCTAAGCTGACCGAC
GTCATTAACGATTCCGTTTCGACCCATCCACCGGTGCTAGAACAGCGTAGCTGCGTTCGCACGTTGGAGGAGCTA
ATCAAGGTCTCTGATGAGTTCCAGATATCGGCCTGCCTACTGTCTGCCATTTCGCAGGACGCCCTACGCGAAGCG
AGCTTATCGTGCTGGGTAGCGCTGCTCGCGAATTTCGAAGAAGAGGACGTCGAGATGTTGATCGAGCCGACGTTC
TTTATCGTCCGCCGCTACTGGGCCGTCTTCAATCGAGGCACGCGCCGCGCTGCCCAGGAGATGCTTGACTTTCTC
CTGGACAAGCACGCCCCGATCATCATGTCTTATATTAACAAGATCCCATCGCTGTCGCCCATCGCTGAGCTGGCC
GATGTCGAATCGAGGCTGTCGGCGCTGAGGCCCGCCTTGGCCACTGACGAGGCGCTGCGTGCTTTTGCCGAGAGA
GTCGCTCACCACAACTCCGGAGTCGTACATCAAGCGTTGACGGAGCTCGTTCCGTACCTCAGAGACAACCAGAGC
GCTCTGTACACTTCGGCAGTCAGCCAGCGCCCGGACAGTGCAGTCACGTCGGTGCTGAGGGCTCTGCTGGACTGC
GCCAGTAAATACAACGGCGTCCAGCTCGACATGTCGCGGCTGTGCGTCGAGTGTGTGGGCCTCATCGGCTGCCTG
GATTCGAACCGGATCGAGAGCGTGAGGGAGCACCGCTCCATCGTCGTGCTGGACAACTTTGAAGGGGTAGGAGAA
GCGACCGACTTTGGCCTGTTCCTCCTACAGGAGGTCCTGGTCCCCTCGTTCCTCTCGGCCACCGACACCAAGCTG
CAGGGCTTCCTCTCCTTTGCGATGCAGGAGCTCCTTATTCGATGCGATATCAAGGCTGCCTGTGCCATGCAGAAC
ACCGGCATGAGGGGCGGCAACGATGTGTACCGCAAATGGATCGCCTTGCCCGAGTACACGCGTGAAATCGTCACG
CCCTTCCTGACTTCACGGTACATGGTAGAGCGGATGGAAAAGGTGATTGTCGAGTATCCCATCTTTCACTTGGGC
AAGCCGTACGGCAACTGGCTGCGGCTATTCGTCGTGGATCTGCTCCGCAACGGTCAGAATGAGCACGCGGATACG
CTATTCGAGCCGCTCACTCGCGTCATTCGCGTCAAGGATCTGTCCACGGCAGAGTTTCTGCTTCCCTACCTGGTG
CTGCACGTGCTTGTCGGGCCCCGAAGCTCCAAGGAGGACAGGGAACGTGTCGTGGGCGAGCTTTTGGTTGTTTTG
AGGTACAACCCGGCCGAGACGGCCTCTTACCTGGAGAAGGAAGAGATGAAGAAGTTTTGTCATGCTGTTTTCCGG
GTCATCGACTACGCAATGAGGTGGATCCAGGCGAAGCGGTCAAAAGGCCGTCTCAGCTCGGTCGATAAAGAGAAC
CTATCGAGGATTCAGGGGATATTGGACGAAATTCCCGCCGAGCTGATCGCGCAACGAGCCCTCGAATGCAACGAG
TACGCTCGAGCTCTCTTCCATCTGGAACAGCACGCGCAGAAGCTTGAGCTCAAGAGCGAGCGAGAGCCCGACGAC
CGTATCAAGCTCTTGGAGAGACTGCAGCATATCTATGCAAACATCGACGAGCCGGACGGGCTGGAGGGCATCTCG
GCCCATCTGCCGGCCCTCGATATCAAGCAGCAGATATTGACTCACAAAAAGGCAGGAAGGTGGACGGCGGCTCAG
ACGTGGTATGAGATGGAGCTGGCCGAGAAGCCGGACAATGCCGACCTGCAGATTGAACTCCTGCGCTGTTTCCAA
CAAGCAGGACAGCATACTCGACTCCTCAACTATGTCGAAAGCCTGCGGACCGAGGGTTCCAACAACAAGGTCACG
CCGTTTGCCGTCGAGGCTGCTTGGGTGACGGGTCAGTGGGAGAGTCTCTCCAAGTTTACCGGTCGATTTCACGGA
GACGTGGTGCAGGACTTTAACATGTCGATGGCGACACTCTTGGACGCGCTGCACAACAAGTCCTCGTCCGATGTC
TTGTCACAGATCGTCGGGAGCGCGCGGGAGAAGATTGCTTCCGAGATGACGGCGTCGGCCACCATGTCCCTGCAG
GCGGCCCATCAACTGTTGCTGCGGTGCCACGTGCTCACAGACTTGGAGATTATCGTCAACCTCAAGCCGGGTGAC
GAGGAGGAACGCAGAAAGACGAAGAGTCTACTGGACGGTCGTCTCGAGGTCATTGGTGCCTACGTCAACGACAAG
CAATATCTTCTCGGCATCAGGCGGGCTGCCATGGAGCTGCTCAGGCCGAGCTATACAGACGCGGACGTCTCCTCG
CTATGGGTGGCGAGCGCTCGGCTGGCCAGGAAGACGGGCTCGCTGCATCAATCCTTCAACGCGGTCCTTCAAGCA
TCTCGACTTGGCGACGACGCAGCGACCATTGAAAACGCGAAACTGCTCTGGAGAGATAGCCATCACAGGCAGGCG
ATTCAGATGCTCCAAGGCGCCATCGAGCGGAACAACTTGACGACACAGGGGGGAACGGCATCTTCGGTGAACACC
AATGTGGCGGCATCGACGAAACTTACGTTGCCTCAGAAGCTCGTGGCTGCCAGAGCGCAGCTGCTGCTGGCCAAG
TGGCTCGATGCCGCGGGACAGTCTCATGCCTCGGCTCTAAGGGAGAAGTATCAACAGCCGCCGAGGACTCATCAC
GCCTGGGAAAAGGGCCATTTCTATCTCGGACGGCATTACAAGAAGATTTTCGACTCGGAGCGGCCGCTCAAGGTG
TCGGATCAGAGCGAAAACTACATCACCGGCGAGGTTACCAGGCTCGTCATCGAGAACTACCTCCGATCGTTGAAC
GTGGGCACCAAGTATCTCTACCAGACGCTGCCCCGTGTCCTGACGCTGTGGCTCGAGATGGGGACCTTGCCCGAC
AAGCCCCTTGAAGGCAAGGCATCCCTCTCGCGAGACACTCACCGGAAACGGGTCGAGCAGCTCAATCTGCTTCAC
GCCTTTCTGGACAGATACATCCATCGGCTCCCGGCGTACGTCTTCTACACGGCCTTGCCGCAGATTGTGGCCCGC
ATCGCACATCCCAATGTGAGCGTCTTTGAGCGCCTCACGCGCATCATCGTCAAGGTGGTCGAGGCGTATCCTCGA
CAGGCGCTCTGGAGCCTCATCGGCATCATGACGTCGAAGCAGGTGACGGAACGCAAGGCGCGGGGCACGCAGATC
TTGCAGGCGCTGAGAACGGTGTCGAAGCGGGTGGAAGGGACGTCTTACGACCTGAAGCAGCTCCTTAGGGCAGGG
GAGAAGCTGGCGGACCAACTCCTGATAGCCTGCAACAACGGCGACTTCTCGGGCAACAAGTCGGTGCAGGCCAGC
CTGTCGCGAGACCTGCGGTTCCAGCACAAGTGCACTCCCTGCCCGCTGGTGGTGCCGGTGGAGAGCTCGCTGAAC
GCGACGCTGCCGGCCGTATCTGAGCACGTGAAGAAGCACACGGCCTTTTCGCGGGACGTGGTGACGATCGACTGC
TTCCTGGACGAGGTGCTGGTGCTGAGCTCGCTGGCCAAGCCCAGGCGACTGACGGCGCGAGGGAGCGACGGCAAG
TGCTATATGTTACTGATCAAGCCCAAGGACGACCTGCGGACGGACCAGCGGCTGATGGAGTTTAACGGCATCATC
AACCGGGCCCTGAAGCACGACGCCGAATCGAGCCGGAGACAGCTGTACATCCGGACCTACGCCGTGGTGCCGCTC
AACGAAGAGTGCGGCGTCATCGAGTGGGTTCCGGGCATCAGGACGATGCGGGACATTTTGTTGAACCTGTACGCG
TCTCGACGGATCCAGCCGGATTACGCGGCGCTCAAGAGCCTGATGGAGGAGGCGTCGACTTCGGAAGCCAAGGTG
CGCATCTTTACAGACGACGTGCTGGGACGGTTCCCGGCCGTGTTACCGGTCTGGTTCCTGCAGCAGTTTCCGAGT
CCCTCGGCCTGGTTCACGGCTCGGCTGCGGTACACTCGCTCGTGCGCCGTCATGTCCATGGTCGGTACCATCCTC
GGGCTCGGGGACCGTCACGGAGAGAACGTGACTCTCGAGGAGGGCAACGGAGGCGTCTTCCACGTCGACTTCAAC
TGCCTGTTCGACAAGGGCCTGACGTTCCAGAAGCCGGAGCGGGTGCCGTTCCGACTGACGCACAACATGGTGGCG
GCAATGGGCGTCTACGGCTACGAGGGCCCGTTCCGAAAGTCGTCGGAGCTGACGCTGAGCATGCTGCGGCAGCAA
GAGGAGACGCTCATGGCCATTCTCGAAGCCTTTATCTACGACCCGACGCTGGACCTGCAGAAGGAGAAGCGCCAT
TCGAGGCGGGGCGACTCGGGCGTCAAGCTGCAGCCGCAGAGCGTCGTCGACAGCATCCGGAGAAAGGTCAGGGGC
TTGCTGCCCAATGAGAGTATTCCCCTGAGCGTCGAGGGGCAGGTCGAGGAGCTGATCAAGCAGGCGGTGGACGCG
AGGAACCTGACGGCCATGTATATCGGATGGTGTCCGTTTCTGTGA
Transcript >Ophun1|5521
ATGGCTTCACTTAGTAGCCTGGTCGTTGACGGCGCAAAGAGGAGAAAGCTTTCCAGCAAAGATTCGCCGTCTTCT
ATGTTGGAGGCCATCTACGAAGCCCTTCAAGTCAAAGAGACTGGAGATGACGATGTCGTCGTGTTCGAGCAACTA
TTCTTAACCGGGTTCGAGACAGCTTCCGAAGATCGTCAATGTCTTGCCGTTGAGCTCTTATCTAGAATATGCTGT
GCCGCAGACGAGTCCTTCTCGATGGATCCCGAAGCCCGATGTCTCATCTGCGAGGGCGCCCGTGACTCTGGCGCA
CTTCGACCTTCCAGCTCCAAAAGCGAGGCCCGACTAGTATTTTGCAAGCTCATCAGGCTGCCCAAGTTTCTCGAG
TCTCAGAGGCCCAGGGTTGTCGCCATGATTGGGCTGAGGAGGCTTGTACATCATTGTGAAGACGGTGATTTCCTG
GATCTAGAACGGTCAGGGTTCGGTGATGTTCTCATTCCAGGACCCGGACAATGGTGTCTCCAGTCGCTCAACAGC
TCTCTGCGGGAGCTTCGAGTCGCTGCCGGGAGAACGTTGCCTACCTTTATGCCTCAGAAGCCCACGCCCGTTTTG
GACGAGGACTTGCTGCACCGAAATCGCAAATGCTCGATCGCGGTGCTCAAGAAGACGTCGGACCAGCATCAACCA
CGTCTAGTGGAAACTCGCATCATGGCCTGGGCGCAACTGGGCCGCGTGGCCACGGAAGATGAGCTGAACCTGGTC
CTCATCAAGCTGCTAGAGTATCTGGGCAGCAGCAACGGCCTCGTCTCGGCTTTCGCGTTCAATGAGCTCCTGAGA
CTCGCCGAGTCTCGTTCGATAACGCCGAGACGTCTGTTCGAACCCTTTTGGAAGAACATGGCTTATATGGCTACC
AAGAACATGGTCCAGCGGCCGCAGCAGAGCCGGGCGATTGCAGAGCTTCTTCAAATCTCCGTCAACGAGCTGCTC
CTCCTGATACAGTCACACGCACTGCCGTGGCTCGTTCTCGACAGACAAGTAGATGTCATCCAGAAGATAGCAGAG
GCCCGGAAAGAAAAGGAGCCTTGGCGCCCACTCATGGACAACTCCAACTTGGCTGCTACTCTGGCATTGCTCCTT
GTTCAGGACGCTGACAACATGGAATCGTTTACGCTATCCCGCCTAAACGATGTTTCTCCACACTTTCACTCGCTC
ACTCTCCTTGATCTCTTCCAAGCCGATCCGGTCTCGATCGCTCTAGAGCTCTTGAGGTTCGCGGCCGGTGCCGAC
GCGGCGCGGCAGCAAGTGATCCACAAGGCTTTGCATCTCCTGGCGACAACTATTCTCAGAAACAACAAGGATACC
AAAGTCAAGAAGAGCAACGTCATCGGGCGCTTTCTTCAATCTCACGTTCTCGGCCTCATGGCTAAGCTGACCGAC
GTCATTAACGATTCCGTTTCGACCCATCCACCGGTGCTAGAACAGCGTAGCTGCGTTCGCACGTTGGAGGAGCTA
ATCAAGGTCTCTGATGAGTTCCAGATATCGGCCTGCCTACTGTCTGCCATTTCGCAGGACGCCCTACGCGAAGCG
AGCTTATCGTGCTGGGTAGCGCTGCTCGCGAATTTCGAAGAAGAGGACGTCGAGATGTTGATCGAGCCGACGTTC
TTTATCGTCCGCCGCTACTGGGCCGTCTTCAATCGAGGCACGCGCCGCGCTGCCCAGGAGATGCTTGACTTTCTC
CTGGACAAGCACGCCCCGATCATCATGTCTTATATTAACAAGATCCCATCGCTGTCGCCCATCGCTGAGCTGGCC
GATGTCGAATCGAGGCTGTCGGCGCTGAGGCCCGCCTTGGCCACTGACGAGGCGCTGCGTGCTTTTGCCGAGAGA
GTCGCTCACCACAACTCCGGAGTCGTACATCAAGCGTTGACGGAGCTCGTTCCGTACCTCAGAGACAACCAGAGC
GCTCTGTACACTTCGGCAGTCAGCCAGCGCCCGGACAGTGCAGTCACGTCGGTGCTGAGGGCTCTGCTGGACTGC
GCCAGTAAATACAACGGCGTCCAGCTCGACATGTCGCGGCTGTGCGTCGAGTGTGTGGGCCTCATCGGCTGCCTG
GATTCGAACCGGATCGAGAGCGTGAGGGAGCACCGCTCCATCGTCGTGCTGGACAACTTTGAAGGGGTAGGAGAA
GCGACCGACTTTGGCCTGTTCCTCCTACAGGAGGTCCTGGTCCCCTCGTTCCTCTCGGCCACCGACACCAAGCTG
CAGGGCTTCCTCTCCTTTGCGATGCAGGAGCTCCTTATTCGATGCGATATCAAGGCTGCCTGTGCCATGCAGAAC
ACCGGCATGAGGGGCGGCAACGATGTGTACCGCAAATGGATCGCCTTGCCCGAGTACACGCGTGAAATCGTCACG
CCCTTCCTGACTTCACGGTACATGGTAGAGCGGATGGAAAAGGTGATTGTCGAGTATCCCATCTTTCACTTGGGC
AAGCCGTACGGCAACTGGCTGCGGCTATTCGTCGTGGATCTGCTCCGCAACGGTCAGAATGAGCACGCGGATACG
CTATTCGAGCCGCTCACTCGCGTCATTCGCGTCAAGGATCTGTCCACGGCAGAGTTTCTGCTTCCCTACCTGGTG
CTGCACGTGCTTGTCGGGCCCCGAAGCTCCAAGGAGGACAGGGAACGTGTCGTGGGCGAGCTTTTGGTTGTTTTG
AGGTACAACCCGGCCGAGACGGCCTCTTACCTGGAGAAGGAAGAGATGAAGAAGTTTTGTCATGCTGTTTTCCGG
GTCATCGACTACGCAATGAGGTGGATCCAGGCGAAGCGGTCAAAAGGCCGTCTCAGCTCGGTCGATAAAGAGAAC
CTATCGAGGATTCAGGGGATATTGGACGAAATTCCCGCCGAGCTGATCGCGCAACGAGCCCTCGAATGCAACGAG
TACGCTCGAGCTCTCTTCCATCTGGAACAGCACGCGCAGAAGCTTGAGCTCAAGAGCGAGCGAGAGCCCGACGAC
CGTATCAAGCTCTTGGAGAGACTGCAGCATATCTATGCAAACATCGACGAGCCGGACGGGCTGGAGGGCATCTCG
GCCCATCTGCCGGCCCTCGATATCAAGCAGCAGATATTGACTCACAAAAAGGCAGGAAGGTGGACGGCGGCTCAG
ACGTGGTATGAGATGGAGCTGGCCGAGAAGCCGGACAATGCCGACCTGCAGATTGAACTCCTGCGCTGTTTCCAA
CAAGCAGGACAGCATACTCGACTCCTCAACTATGTCGAAAGCCTGCGGACCGAGGGTTCCAACAACAAGGTCACG
CCGTTTGCCGTCGAGGCTGCTTGGGTGACGGGTCAGTGGGAGAGTCTCTCCAAGTTTACCGGTCGATTTCACGGA
GACGTGGTGCAGGACTTTAACATGTCGATGGCGACACTCTTGGACGCGCTGCACAACAAGTCCTCGTCCGATGTC
TTGTCACAGATCGTCGGGAGCGCGCGGGAGAAGATTGCTTCCGAGATGACGGCGTCGGCCACCATGTCCCTGCAG
GCGGCCCATCAACTGTTGCTGCGGTGCCACGTGCTCACAGACTTGGAGATTATCGTCAACCTCAAGCCGGGTGAC
GAGGAGGAACGCAGAAAGACGAAGAGTCTACTGGACGGTCGTCTCGAGGTCATTGGTGCCTACGTCAACGACAAG
CAATATCTTCTCGGCATCAGGCGGGCTGCCATGGAGCTGCTCAGGCCGAGCTATACAGACGCGGACGTCTCCTCG
CTATGGGTGGCGAGCGCTCGGCTGGCCAGGAAGACGGGCTCGCTGCATCAATCCTTCAACGCGGTCCTTCAAGCA
TCTCGACTTGGCGACGACGCAGCGACCATTGAAAACGCGAAACTGCTCTGGAGAGATAGCCATCACAGGCAGGCG
ATTCAGATGCTCCAAGGCGCCATCGAGCGGAACAACTTGACGACACAGGGGGGAACGGCATCTTCGGTGAACACC
AATGTGGCGGCATCGACGAAACTTACGTTGCCTCAGAAGCTCGTGGCTGCCAGAGCGCAGCTGCTGCTGGCCAAG
TGGCTCGATGCCGCGGGACAGTCTCATGCCTCGGCTCTAAGGGAGAAGTATCAACAGCCGCCGAGGACTCATCAC
GCCTGGGAAAAGGGCCATTTCTATCTCGGACGGCATTACAAGAAGATTTTCGACTCGGAGCGGCCGCTCAAGGTG
TCGGATCAGAGCGAAAACTACATCACCGGCGAGGTTACCAGGCTCGTCATCGAGAACTACCTCCGATCGTTGAAC
GTGGGCACCAAGTATCTCTACCAGACGCTGCCCCGTGTCCTGACGCTGTGGCTCGAGATGGGGACCTTGCCCGAC
AAGCCCCTTGAAGGCAAGGCATCCCTCTCGCGAGACACTCACCGGAAACGGGTCGAGCAGCTCAATCTGCTTCAC
GCCTTTCTGGACAGATACATCCATCGGCTCCCGGCGTACGTCTTCTACACGGCCTTGCCGCAGATTGTGGCCCGC
ATCGCACATCCCAATGTGAGCGTCTTTGAGCGCCTCACGCGCATCATCGTCAAGGTGGTCGAGGCGTATCCTCGA
CAGGCGCTCTGGAGCCTCATCGGCATCATGACGTCGAAGCAGGTGACGGAACGCAAGGCGCGGGGCACGCAGATC
TTGCAGGCGCTGAGAACGGTGTCGAAGCGGGTGGAAGGGACGTCTTACGACCTGAAGCAGCTCCTTAGGGCAGGG
GAGAAGCTGGCGGACCAACTCCTGATAGCCTGCAACAACGGCGACTTCTCGGGCAACAAGTCGGTGCAGGCCAGC
CTGTCGCGAGACCTGCGGTTCCAGCACAAGTGCACTCCCTGCCCGCTGGTGGTGCCGGTGGAGAGCTCGCTGAAC
GCGACGCTGCCGGCCGTATCTGAGCACGTGAAGAAGCACACGGCCTTTTCGCGGGACGTGGTGACGATCGACTGC
TTCCTGGACGAGGTGCTGGTGCTGAGCTCGCTGGCCAAGCCCAGGCGACTGACGGCGCGAGGGAGCGACGGCAAG
TGCTATATGTTACTGATCAAGCCCAAGGACGACCTGCGGACGGACCAGCGGCTGATGGAGTTTAACGGCATCATC
AACCGGGCCCTGAAGCACGACGCCGAATCGAGCCGGAGACAGCTGTACATCCGGACCTACGCCGTGGTGCCGCTC
AACGAAGAGTGCGGCGTCATCGAGTGGGTTCCGGGCATCAGGACGATGCGGGACATTTTGTTGAACCTGTACGCG
TCTCGACGGATCCAGCCGGATTACGCGGCGCTCAAGAGCCTGATGGAGGAGGCGTCGACTTCGGAAGCCAAGGTG
CGCATCTTTACAGACGACGTGCTGGGACGGTTCCCGGCCGTGTTACCGGTCTGGTTCCTGCAGCAGTTTCCGAGT
CCCTCGGCCTGGTTCACGGCTCGGCTGCGGTACACTCGCTCGTGCGCCGTCATGTCCATGGTCGGTACCATCCTC
GGGCTCGGGGACCGTCACGGAGAGAACGTGACTCTCGAGGAGGGCAACGGAGGCGTCTTCCACGTCGACTTCAAC
TGCCTGTTCGACAAGGGCCTGACGTTCCAGAAGCCGGAGCGGGTGCCGTTCCGACTGACGCACAACATGGTGGCG
GCAATGGGCGTCTACGGCTACGAGGGCCCGTTCCGAAAGTCGTCGGAGCTGACGCTGAGCATGCTGCGGCAGCAA
GAGGAGACGCTCATGGCCATTCTCGAAGCCTTTATCTACGACCCGACGCTGGACCTGCAGAAGGAGAAGCGCCAT
TCGAGGCGGGGCGACTCGGGCGTCAAGCTGCAGCCGCAGAGCGTCGTCGACAGCATCCGGAGAAAGGTCAGGGGC
TTGCTGCCCAATGAGAGTATTCCCCTGAGCGTCGAGGGGCAGGTCGAGGAGCTGATCAAGCAGGCGGTGGACGCG
AGGAACCTGACGGCCATGTATATCGGATGGTGTCCGTTTCTGTGA
Gene >Ophun1|5521
ATGGCTTCACTTAGTAGCCTGGTCGTTGACGGCGCAAAGAGGAGAAAGCTTTCCAGCAAAGATTCGCCGTCTTCT
ATGTTGGAGGCCATCTACGAAGCCCTTCAAGTCAAAGAGACTGGAGATGACGATGTCGTCGTGTTCGAGCAACTA
TTCTTGTGAGTTTTCGTCGTTTCTGATGAGCTCGCTCTAATGTGTCTGTTCATAGAACCGGGTTCGAGACAGCTT
CCGAAGATCGTCAATGTCTTGCCGTTGAGCTCTTATCTAGAATATGCTGTGCCGCAGACGAGTCCTTCTCGATGG
ATCCCGAAGCCCGATGTCTCATCTGCGAGGGCGCCCGTGACTCTGGCGCACTTCGACCTTCCAGCTCCAAAAGCG
AGGCCCGACTAGTATTTTGCAAGCTCATCAGGCTGCCCAAGTTTCTCGAGTCTCAGAGGCCCAGGGTTGTCGCCA
TGATTGGGCTGAGGAGGCTTGTACATCATTGTGAAGACGGTGATTTCCTGGATCTAGAACGGTCAGGGTTCGGTG
ATGTTCTCATTCCAGGACCCGGACAATGGTGTCTCCAGTCGCTCAACAGCTCTCTGCGGGAGCTTCGAGTCGCTG
CCGGGAGAACGTTGCCTACCTTTATGCCTCAGAAGCCCACGCCCGTTTTGGACGAGGACTTGCTGCACCGAAATC
GCAAATGCTCGATCGCGGTGCTCAAGAAGACGTCGGACCAGCATCAACCACGTCTAGTGGAAACTCGCATCATGG
CCTGGGCGCAACTGGGCCGCGTGGCCACGGAAGATGAGCTGAACCTGGTCCTCATCAAGCTGCTAGAGTATCTGG
GCAGCAGCAACGGCCTCGTCTCGGCTTTCGCGTTCAATGAGCTCCTGAGACTCGCCGAGTCTCGTTCGATAACGC
CGAGACGTCTGTTCGAACCCTTTTGGAAGAACATGGCTTATATGGCTACCAAGAACATGGTCCAGCGGCCGCAGC
AGAGCCGGGCGATTGCAGAGCTTCTTCAAATCTCCGTCAACGAGCTGCTCCTCCTGATACAGTCACACGCACTGC
CGTGGCTCGTTCTCGACAGACAAGTAGATGTCATCCAGAAGATAGCAGAGGCCCGGAAAGAAAAGGAGCCTTGGC
GCCCACTCATGGACAACTCCAACTTGGCTGCTACTCTGGCATTGCTCCTTGTTCAGGACGCTGACAACATGGAAT
CGTTTACGCTATCCCGCCTAAACGATGTTTCTCCACACTTTCACTCGCTCACTCTCCTTGATCTCTTCCAAGCCG
ATCCGGTCTCGATCGCTCTAGAGCTCTTGAGGTTCGCGGCCGGTGCCGACGCGGCGCGGCAGCAAGTGGTAAGTG
AAGACGTGCCACACGGCGAGCGTACGGCTTGCTGATCCGCGATAGATCCACAAGGCTTTGCATCTCCTGGCGACA
ACTATTCTCAGAAACAACAAGGATACCAAAGTCAAGAAGAGCAACGTCATCGGGCGCTTTCTTCAATCTCACGTT
CTCGGCCTCATGGCTAAGCTGACCGACGTCATTAACGATTCCGTTTCGACCCATCCACCGGTGCTAGAACAGCGT
AGCTGCGTTCGCACGTTGGAGGAGCTAATCAAGGTCTGTAAGAGCTATGCGAGGATTGCACGGCCACAGGTATGA
GCTCGAGCAGAGATGACTACTCCCCCGACGCAGCTGATGAGTTCCAGATATCGGCCTGCCTACTGTCTGCCATTT
CGCAGGACGCCCTACGCGAAGCGAGCTTATCGTGCTGGGTAGCGCTGCTCGCGAATTTCGAAGAAGAGGACGTCG
AGATGTTGATCGAGCCGACGTTCTTTATCGTCCGCCGCTACTGGGCCGTCTTCAATCGAGGCACGCGCCGCGCTG
CCCAGGAGATGCTTGACTTTCTCCTGGACAAGCACGCCCCGATCATCATGTCTTATATTAACAAGATCCCATCGC
TGTCGCCCATCGCTGAGCTGGCCGATGTCGAATCGAGGCTGTCGGCGCTGAGGCCCGCCTTGGCCACTGACGAGG
CGCTGCGTGCTTTTGCCGAGAGAGTCGCTCACCACAACTCCGGAGTCGTACATCAAGCGTTGACGGAGCTCGTTC
CGTACCTCAGAGACAACCAGAGCGCTCTGTACACTTCGGCAGTCAGCCAGCGCCCGGACAGTGCAGTCACGTCGG
TGCTGAGGGCTCTGCTGGACTGCGCCAGTAAATACAACGGCGTCCAGCTCGACATGTCGCGGCTGTGCGTCGAGT
GTGTGGGCCTCATCGGCTGCCTGGATTCGAACCGGATCGAGAGCGTGAGGGAGCACCGCTCCATCGTCGTGCTGG
ACAACTTTGAAGGGGTAGGAGAAGCGACCGACTTTGGCCTGTTCCTCCTACAGGAGGTCCTGGTCCCCTCGTTCC
TCTCGGCCACCGACACCAAGCTGCAGGGCTTCCTCTCCTTTGCGATGCAGGAGCTCCTTATTCGATGCGATATCA
AGGCTGCCTGTGCCATGCAGAACACCGGCATGAGGGGCGGCAACGATGTGTACCGCAAATGGATCGCCTTGCCCG
AGTACACGCGTGAAATCGTCACGCCCTTCCTGACTTCACGGTACATGGTAGAGCGGATGGAAAAGGTGATTGTCG
AGTATCCCATCTTTCACTTGGGCAAGCCGTACGGCAACTGGCTGCGGCTATTCGTCGTGGATCTGCTCCGCAACG
GTCAGAATGAGCACGCGGATACGCTATTCGAGCCGCTCACTCGCGTCATTCGCGTCAAGGATCTGTCCACGGCAG
AGTTTCTGCTTCCCTACCTGGTGCTGCACGTGCTTGTCGGGCCCCGAAGCTCCAAGGAGGACAGGGAACGTGTCG
TGGGCGAGCTTTTGGTTGTTTTGAGGTACAACCCGGCCGAGACGGCCTCTTACCTGGAGAAGGAAGAGATGAAGA
AGTTTTGTCATGTGCGTCTGCATGTCCCTCAAACACACGTGGCATACACTGATGCAGATTCAGGCTGTTTTCCGG
GTCATCGACTACGCAATGAGGTGGATCCAGGCGAAGCGGTCAAAAGGCCGTCTCAGCTCGGTCGATAAAGAGAAC
CTATCGAGGATTCAGGGGATATTGGACGAAATTCCCGCCGAGCTGATCGCGCAACGAGCCCTCGAATGCAACGAG
TACGCTCGAGCTCTCTTCCATCTGGAACAGCACGCGCAGAAGCTTGAGCTCAAGAGCGAGCGAGAGCCCGACGAC
CGTATCAAGCTCTTGGAGAGACTGCAGCATATCTATGCAAACATCGACGAGCCGGACGGGCTGGAGGGCATCTCG
GCCCATCTGCCGGCCCTCGATATCAAGCAGCAGATATTGACTCACAAAAAGGCAGGAAGGTGGACGGCGGCTCAG
ACGTGGTATGAGATGGAGCTGGCCGAGAAGCCGGACAATGCCGACCTGCAGATTGAACTCCTGCGCTGTTTCCAA
CAAGCAGGACAGCATAGTAGGTGTCAGGCCCCCGCCGGAGCAAGTTTATCATCTAACATGGCATCAGCTCGACTC
CTCAACTATGTCGAAAGCCTGCGGACCGAGGGTTCCAACAACAAGGTCACGCCGTTTGCCGTCGAGGCTGCTTGG
GTGACGGGTCAGTGGGAGAGTCTCTCCAAGTTTACCGGTCGATTTCACGGAGACGTGGTGCAGGACTTTAACATG
TCGATGGCGACACTCTTGGACGCGCTGCACAACAAGTCCTCGTCCGATGTCTTGTCACAGATCGTCGGGAGCGCG
CGGGAGAAGATTGCTTCCGAGATGACGGCGTCGGCCACCATGTCCCTGCAGGCGGCCCATCAACTGTTGCTGCGG
TGCCACGTGCTCACAGACTTGGAGATTATCGTCAACCTCAAGCCGGGTGACGAGGAGGAACGCAGAAAGACGAAG
AGTCTACTGGACGGTCGTCTCGAGGTCATTGGTGCCTACGTCAACGACAAGCAATATCTTCTCGGCATCAGGCGG
GCTGCCATGGAGCTGCTCAGGTGAGTTCTTTCGCAATTGCCAGTGAGAAGCTCAGGCGGCTAAGGGGGAACAGGC
CGAGCTATACAGACGCGGACGTCTCCTCGCTATGGGTGGCGAGCGCTCGGCTGGCCAGGAAGACGGGCTCGCTGC
ATCAATCCTTCAACGCGGTCCTTCAAGCATCTCGACTTGGCGACGACGCAGCGACCATTGAAAACGCGAAACTGC
TCTGGAGAGATAGCCATCACAGGCAGGCGATTCAGATGCTCCAAGGCGCCATCGAGCGGAACAACTTGACGACAC
AGGGGGGAACGGCATCTTCGGTGAACACCAATGTGGCGGCATCGACGAAACTTACGTTGCCTCAGAAGCTCGTGG
CTGCCAGAGCGCAGCTGCTGCTGGCCAAGTGGCTCGATGCCGCGGGACAGTCTCATGCCTCGGCTCTAAGGGAGA
AGTATCAACAGCCGCCGAGGACTCATCACGCCTGGGAAAAGGGCCATTTCTATCTCGGACGGCATTACAAGAAGA
TTTTCGACTCGGAGCGGCCGCTCAAGGTGTCGGATCAGAGCGAAAACTACATCACCGGCGAGGTTACCAGGCTCG
TCATCGAGAACTACCTCCGATCGTTGAACGTGGGCACCAAGTATCTCTACCAGACGCTGCCCCGTGTCCTGACGC
TGTGGCTCGAGATGGGGACCTTGCCCGACAAGCCCCTTGAAGGCAAGGCATCCCTCTCGCGAGACACTCACCGGA
AACGGGTCGAGCAGCTCAATCTGCTTCACGCCTTTCTGGACAGATACATCCATCGGCTCCCGGCGTACGTCTTCT
ACACGGCCTTGCCGCAGATTGTGGCCCGCATCGCACATCCCAATGTGAGCGTCTTTGAGCGCCTCACGCGCATCA
TCGTCAAGGTGGTCGAGGCGTATCCTCGACAGGCGCTCTGGAGCCTCATCGGCATCATGACGTCGAAGCAGGTGA
CGGAACGCAAGGCGCGGGGCACGCAGATCTTGCAGGCGCTGAGAACGGTGTCGAAGCGGGTGGAAGGGACGTCTT
ACGACCTGAAGCAGCTCCTTAGGGCAGGGGAGAAGCTGGCGGACCAACTCCTGATAGCCTGCAACAACGGCGACT
TCTCGGGCAACAAGTCGGTGCAGGCCAGCCTGTCGCGAGACCTGCGGTTCCAGCACAAGTGCACTCCCTGCCCGC
TGGTGGTGCCGGTGGAGAGCTCGCTGAACGCGACGCTGCCGGCCGTATCTGAGCACGTGAAGAAGCACACGGCCT
TTTCGCGGGACGTGGTGACGATCGACTGCTTCCTGGACGAGGTGCTGGTGCTGAGCTCGCTGGCCAAGCCCAGGC
GACTGACGGCGCGAGGGAGCGACGGCAAGTGCTATATGTTACTGATCAAGCCCAAGGACGACCTGCGGACGGACC
AGCGGCTGATGGAGTTTAACGGCATCATCAACCGGGCCCTGAAGCACGACGCCGAATCGAGCCGGAGACAGCTGT
ACATCCGGACCTACGCCGTGGTGCCGCTCAACGAAGAGTGCGGCGTCATCGAGTGGGTTCCGGGCATCAGGACGA
TGCGGGACATTTTGTTGAACCTGTACGCGTCTCGACGGATCCAGCCGGATTACGCGGCGCTCAAGAGCCTGATGG
AGGAGGCGTCGACTTCGGAAGCCAAGGTGCGCATCTTTACAGACGACGTGCTGGGACGGTTCCCGGCCGTGTTAC
CGGTCTGGTTCCTGCAGCAGTTTCCGAGTCCCTCGGCCTGGTTCACGGCTCGGCTGCGGTACACTCGCTCGTGCG
CCGTCATGTCCATGGTCGGTACCATCCTCGGGCTCGGGGACCGTCACGGAGAGAACGTGACTCTCGAGGAGGGCA
ACGGAGGCGTCTTCCACGTCGACTTCAACTGCCTGTTCGACAAGGGCCTGACGTTCCAGAAGCCGGAGCGGGTGC
CGTTCCGACTGACGCACAACATGGTGGCGGCAATGGGCGTCTACGGCTACGAGGGCCCGTTCCGAAAGTCGTCGG
AGCTGACGCTGAGCATGCTGCGGCAGCAAGAGGAGACGCTCATGGCCATTCTCGAAGCCTTTATCTACGACCCGA
CGCTGGACCTGCAGAAGGAGAAGCGCCATTCGAGGCGGGGCGACTCGGGCGTCAAGCTGCAGCCGCAGAGCGTCG
TCGACAGCATCCGGAGAAAGGTCAGGGGCTTGCTGCCCAATGAGAGTATTCCCCTGAGCGTCGAGGGGCAGGTCG
AGGAGCTGATCAAGCAGGCGGTGGACGCGAGGAACCTGACGGCCATGTATATCGGATGGTGTCCGTTTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail