Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|552
Gene name
LocationContig_117:25582..26889
Strand-
Gene length (bp)1307
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04004 Leo1 Leo1-like protein 1.4E-32 84 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WVC0|LEO1_HUMAN RNA polymerase-associated protein LEO1 OS=Homo sapiens GN=LEO1 PE=1 SV=1 67 290 7.0E-09
sp|Q5XJE5|LEO1_MOUSE RNA polymerase-associated protein LEO1 OS=Mus musculus GN=Leo1 PE=1 SV=2 67 290 7.0E-09
sp|Q6NYV9|LEO1_DANRE RNA polymerase-associated protein LEO1 OS=Danio rerio GN=leo1 PE=1 SV=1 15 290 1.0E-08
sp|Q641X2|LEO1_RAT RNA polymerase-associated protein LEO1 OS=Rattus norvegicus GN=Leo1 PE=1 SV=1 67 290 2.0E-08
sp|Q5R4D6|LEO1_PONAB RNA polymerase-associated protein LEO1 OS=Pongo abelii GN=LEO1 PE=2 SV=1 67 290 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WVC0|LEO1_HUMAN RNA polymerase-associated protein LEO1 OS=Homo sapiens GN=LEO1 PE=1 SV=1 67 290 7.0E-09
sp|Q5XJE5|LEO1_MOUSE RNA polymerase-associated protein LEO1 OS=Mus musculus GN=Leo1 PE=1 SV=2 67 290 7.0E-09
sp|Q6NYV9|LEO1_DANRE RNA polymerase-associated protein LEO1 OS=Danio rerio GN=leo1 PE=1 SV=1 15 290 1.0E-08
sp|Q641X2|LEO1_RAT RNA polymerase-associated protein LEO1 OS=Rattus norvegicus GN=Leo1 PE=1 SV=1 67 290 2.0E-08
sp|Q5R4D6|LEO1_PONAB RNA polymerase-associated protein LEO1 OS=Pongo abelii GN=LEO1 PE=2 SV=1 67 290 2.0E-08
sp|Q52KV5|LEO1_XENLA RNA polymerase-associated protein LEO1 OS=Xenopus laevis GN=leo1 PE=2 SV=1 74 290 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006368 transcription elongation from RNA polymerase II promoter Yes
GO:0016593 Cdc73/Paf1 complex Yes
GO:0016570 histone modification Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0140513 nuclear protein-containing complex No
GO:0032991 protein-containing complex No
GO:0019538 protein metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0006354 DNA-templated transcription, elongation No
GO:0044237 cellular metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0008023 transcription elongation factor complex No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0005575 cellular_component No
GO:0036211 protein modification process No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|552
MSDSEDPLDAVDEGADDLFGEEDAASPAPRHDDDLASDPDEAADAQNVDDEDAQHLQETRDKVVADIPTYRHRIP
KPKDAMLRILRVPKFIKFMPEVYDPDTFEPSEFDVANAKAEQPKAVVRVRRDPTTGELKSNTNMYRWSDGSVTIA
VGGEHYDIQKKSLASAPDKPYNELQDGYCYAAAAELDSNLLMTIGHLMEQYNVKPNKAVGDDALSIFADRMAQAS
KAMKGEDMIVRTTRDPELQKKQAELAEKERMKAQRRRENAAARMDGGPSRSARGGLSIGDLEGDRRGAATGRKKG
ASGPAKTKRRRPEYDSDDDLPQGVGRHEDYDMDDGFLVASDVEEMESGAADEDEEEEDDRLDYAKTDAGRRAKKQ
RVAEPEADEDAEGDEIEPMPTDTAGRTRRRNVVDDEDEE*
Coding >Ophun1|552
ATGTCAGACTCGGAAGATCCCCTTGACGCCGTCGACGAAGGCGCCGATGATCTCTTCGGTGAGGAGGACGCCGCC
TCGCCCGCGCCCCGTCATGACGATGACCTCGCTTCCGACCCTGACGAGGCGGCCGATGCGCAAAACGTCGACGAC
GAAGACGCCCAACACCTTCAGGAGACGCGCGACAAGGTCGTCGCCGACATTCCCACATATCGTCATCGCATCCCC
AAGCCAAAGGACGCCATGCTGCGGATACTGCGCGTGCCAAAATTCATAAAGTTCATGCCTGAAGTCTACGATCCA
GATACCTTTGAGCCCTCCGAGTTTGACGTCGCCAACGCAAAAGCCGAGCAGCCCAAGGCGGTCGTCCGCGTCCGA
CGCGACCCTACCACCGGCGAGCTCAAGAGCAACACAAACATGTATCGCTGGTCTGATGGCTCCGTCACCATTGCC
GTAGGCGGAGAGCACTACGACATCCAGAAAAAGTCGCTCGCCTCCGCCCCGGACAAGCCCTACAACGAACTCCAA
GACGGATACTGCTACGCCGCGGCCGCCGAGCTCGATAGCAACTTGCTCATGACAATCGGCCATTTGATGGAGCAG
TACAATGTCAAGCCCAACAAGGCGGTGGGAGACGACGCCCTGAGCATCTTTGCCGACCGCATGGCCCAGGCCAGC
AAGGCGATGAAGGGCGAGGACATGATTGTCCGCACAACGAGGGATCCCGAGCTACAAAAGAAGCAAGCCGAGCTA
GCCGAAAAAGAGAGGATGAAGGCCCAACGTCGTCGCGAAAATGCAGCGGCCAGGATGGACGGCGGACCCTCGCGC
TCCGCCCGCGGCGGTCTCTCCATAGGAGACCTCGAAGGCGATCGGCGAGGTGCCGCCACGGGGCGCAAGAAGGGA
GCTTCAGGTCCGGCCAAGACCAAGCGGCGGCGTCCCGAGTACGACTCAGACGACGACTTGCCGCAGGGCGTGGGA
CGACACGAAGACTACGACATGGACGATGGCTTCCTCGTCGCCAGTGACGTCGAGGAGATGGAGAGCGGCGCCGCA
GACGAAGACGAAGAAGAAGAAGATGACAGGCTCGACTACGCAAAGACGGATGCAGGCCGCCGCGCCAAAAAGCAG
CGCGTCGCCGAACCCGAAGCAGACGAGGACGCCGAGGGAGACGAGATCGAGCCCATGCCCACCGACACCGCAGGC
CGGACTCGCAGACGGAACGTGGTGGACGACGAGGACGAAGAGTGA
Transcript >Ophun1|552
ATGTCAGACTCGGAAGATCCCCTTGACGCCGTCGACGAAGGCGCCGATGATCTCTTCGGTGAGGAGGACGCCGCC
TCGCCCGCGCCCCGTCATGACGATGACCTCGCTTCCGACCCTGACGAGGCGGCCGATGCGCAAAACGTCGACGAC
GAAGACGCCCAACACCTTCAGGAGACGCGCGACAAGGTCGTCGCCGACATTCCCACATATCGTCATCGCATCCCC
AAGCCAAAGGACGCCATGCTGCGGATACTGCGCGTGCCAAAATTCATAAAGTTCATGCCTGAAGTCTACGATCCA
GATACCTTTGAGCCCTCCGAGTTTGACGTCGCCAACGCAAAAGCCGAGCAGCCCAAGGCGGTCGTCCGCGTCCGA
CGCGACCCTACCACCGGCGAGCTCAAGAGCAACACAAACATGTATCGCTGGTCTGATGGCTCCGTCACCATTGCC
GTAGGCGGAGAGCACTACGACATCCAGAAAAAGTCGCTCGCCTCCGCCCCGGACAAGCCCTACAACGAACTCCAA
GACGGATACTGCTACGCCGCGGCCGCCGAGCTCGATAGCAACTTGCTCATGACAATCGGCCATTTGATGGAGCAG
TACAATGTCAAGCCCAACAAGGCGGTGGGAGACGACGCCCTGAGCATCTTTGCCGACCGCATGGCCCAGGCCAGC
AAGGCGATGAAGGGCGAGGACATGATTGTCCGCACAACGAGGGATCCCGAGCTACAAAAGAAGCAAGCCGAGCTA
GCCGAAAAAGAGAGGATGAAGGCCCAACGTCGTCGCGAAAATGCAGCGGCCAGGATGGACGGCGGACCCTCGCGC
TCCGCCCGCGGCGGTCTCTCCATAGGAGACCTCGAAGGCGATCGGCGAGGTGCCGCCACGGGGCGCAAGAAGGGA
GCTTCAGGTCCGGCCAAGACCAAGCGGCGGCGTCCCGAGTACGACTCAGACGACGACTTGCCGCAGGGCGTGGGA
CGACACGAAGACTACGACATGGACGATGGCTTCCTCGTCGCCAGTGACGTCGAGGAGATGGAGAGCGGCGCCGCA
GACGAAGACGAAGAAGAAGAAGATGACAGGCTCGACTACGCAAAGACGGATGCAGGCCGCCGCGCCAAAAAGCAG
CGCGTCGCCGAACCCGAAGCAGACGAGGACGCCGAGGGAGACGAGATCGAGCCCATGCCCACCGACACCGCAGGC
CGGACTCGCAGACGGAACGTGGTGGACGACGAGGACGAAGAGTGA
Gene >Ophun1|552
ATGTCAGACTCGGAAGATCCCCTTGACGCCGTCGACGAAGGCGCCGATGATCTCTTCGGTGAGGAGGACGCCGCC
TCGCCCGCGCCCCGTCATGACGATGACCTCGCTTCCGACCCTGACGAGGCGGCCGATGCGCAAAACGTCGACGAC
GAAGACGCCCAACACCTTCAGGAGACGCGCGACAAGGTCGTCGCCGACATTCCCACATATCGTCATCGCATCCCC
AAGCCAAAGGACGCCATGGTGAGTCCAAAGCCATCTACACCTCTGCCCGCCGCCATGCTGACCCTTTCCCCGTCT
TCCAGCTGCGGATACTGCGCGTGCCAAAATTCATAAAGTTCATGCCTGAAGTCTACGATCCAGATACCTTTGAGC
CCTCCGAGTTTGACGTCGCCAACGCAAAAGCCGAGCAGCCCAAGGCGGTCGTCCGCGTCCGACGCGACCCTACCA
CCGGCGAGCTCAAGAGCAACACAAACATGTATCGCTGGTCTGATGGCTCCGTCACCATTGCCGTAGGCGGAGAGC
ACTACGACATCCAGAAAAAGTCGCTCGCCTCCGCCCCGGACAAGCCCTACAACGAACTCCAAGACGGATACTGCT
ACGCCGCGGCCGCCGAGCTCGATAGCAACTTGCTCATGACAATCGGCCATTTGATGGAGCAGTACAATGTCAAGC
CCAACAAGGCGGTGGGAGACGACGCCCTGAGCATCTTTGCCGACCGCATGGCCCAGGCCAGCAAGGCGATGAAGG
GCGAGGACATGATTGTCCGCACAACGAGGGATCCCGAGCTACAAAAGAAGCAAGCCGAGCTAGCCGAAAAAGAGA
GGATGAAGGCCCAACGTCGTCGCGAAAATGCAGCGGCCAGGATGGACGGCGGACCCTCGCGCTCCGCCCGCGGCG
GTCTCTCCATAGGAGACCTCGAAGGCGATCGGCGAGGTGCCGCCACGGGGCGCAAGAAGGGAGCTTCAGGTCCGG
CCAAGACCAAGCGGCGGCGTCCCGAGTACGACTCAGACGACGACTTGCCGCAGGGCGTGGGACGACACGAAGACT
ACGACATGGACGATGGCTTCCTCGTCGCCAGTGACGTCGAGGAGATGGAGAGCGGCGCCGCAGACGAAGACGAAG
AAGAAGAAGATGACAGGCTCGACTACGCAAAGACGGATGCAGGCCGCCGCGCCAAAAAGCAGCGCGTCGCCGAAC
CCGAAGCAGACGAGGACGCCGAGGGAGACGAGATCGAGCCCATGCCCACCGACACCGCAGGCCGGACTCGCAGAC
GGAACGTGGTGGACGACGAGGACGAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail