Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5506
Gene name
LocationContig_549:4820..5450
Strand+
Gene length (bp)630
Transcript length (bp)441
Coding sequence length (bp)441
Protein length (aa) 147

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02109 DAD DAD family 4.6E-41 44 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBB4|DAD1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Pongo abelii GN=DAD1 PE=3 SV=3 40 145 1.0E-27
sp|P46967|DAD1_XENLA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 OS=Xenopus laevis GN=dad1 PE=3 SV=1 51 145 2.0E-27
sp|P61805|DAD1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Rattus norvegicus GN=Dad1 PE=3 SV=3 40 145 2.0E-27
sp|P61804|DAD1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mus musculus GN=Dad1 PE=1 SV=3 40 145 2.0E-27
sp|P61806|DAD1_MESAU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mesocricetus auratus GN=DAD1 PE=3 SV=3 40 145 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RBB4|DAD1_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Pongo abelii GN=DAD1 PE=3 SV=3 40 145 1.0E-27
sp|P46967|DAD1_XENLA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 OS=Xenopus laevis GN=dad1 PE=3 SV=1 51 145 2.0E-27
sp|P61805|DAD1_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Rattus norvegicus GN=Dad1 PE=3 SV=3 40 145 2.0E-27
sp|P61804|DAD1_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mus musculus GN=Dad1 PE=1 SV=3 40 145 2.0E-27
sp|P61806|DAD1_MESAU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mesocricetus auratus GN=DAD1 PE=3 SV=3 40 145 2.0E-27
sp|P61803|DAD1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Homo sapiens GN=DAD1 PE=1 SV=3 40 145 2.0E-27
sp|Q29036|DAD1_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Sus scrofa GN=DAD1 PE=3 SV=3 40 145 3.0E-27
sp|Q5E9C2|DAD1_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Bos taurus GN=DAD1 PE=3 SV=3 40 145 4.0E-27
sp|Q9VLM5|DAD1_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Drosophila melanogaster GN=l(2)k12914 PE=3 SV=1 40 145 2.0E-25
sp|O13113|DAD1_CHICK Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Gallus gallus GN=DAD1 PE=2 SV=1 37 146 2.0E-23
sp|P52872|DAD1_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 OS=Caenorhabditis elegans GN=dad-1 PE=3 SV=1 45 145 3.0E-23
sp|Q8I7Z2|DAD1_ARAVE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Araneus ventricosus GN=DAD1 PE=2 SV=1 39 145 5.0E-23
sp|Q54FB6|DAD1_DICDI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Dictyostelium discoideum GN=ost2 PE=3 SV=1 30 145 7.0E-23
sp|P46964|OST2_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST2 PE=1 SV=3 29 146 8.0E-21
sp|Q9M3T9|DAD1_BETPN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Betula pendula GN=DAD1 PE=3 SV=1 35 145 4.0E-18
sp|Q9ZWQ7|DAD1_CITUN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Citrus unshiu GN=DAD1 PE=3 SV=1 35 145 7.0E-18
sp|Q39080|DAD1_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Arabidopsis thaliana GN=DAD1 PE=2 SV=2 35 145 1.0E-17
sp|O65085|DAD1_PICMA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Picea mariana GN=DAD1 PE=3 SV=1 44 145 6.0E-17
sp|O24060|DAD1_MALDO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Malus domestica GN=DAD1 PE=3 SV=1 44 145 6.0E-17
sp|Q9SMC4|DAD1_SOLLC Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Solanum lycopersicum GN=DAD1 PE=3 SV=1 44 145 7.0E-17
sp|Q9SME8|DAD2_HORVU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2 OS=Hordeum vulgare GN=DAD2 PE=3 SV=1 45 145 7.0E-17
sp|Q0JDK9|DAD1_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Oryza sativa subsp. japonica GN=DAD1 PE=3 SV=1 28 145 1.0E-16
sp|A2XSY1|DAD1_ORYSI Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Oryza sativa subsp. indica GN=DAD1 PE=3 SV=1 28 145 1.0E-16
sp|O22622|DAD2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2 OS=Arabidopsis thaliana GN=DAD2 PE=2 SV=1 57 145 6.0E-16
sp|Q9SME9|DAD1_HORVU Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Hordeum vulgare GN=DAD1 PE=3 SV=1 28 145 1.0E-15
sp|Q9ZRA3|DAD1_PEA Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Pisum sativum GN=DAD1 PE=3 SV=1 57 145 3.0E-15
sp|O14238|OST2_SCHPO Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost2 PE=3 SV=1 46 145 2.0E-14
sp|O81214|DAD1_MAIZE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (Fragment) OS=Zea mays GN=DAD1 PE=2 SV=2 77 145 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008250 oligosaccharyltransferase complex Yes
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:1990234 transferase complex No
GO:1902494 catalytic complex No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0140534 endoplasmic reticulum protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 93 115 22
3 125 144 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5506
MAPKKPARGDNNAPSPARNVSSGTATPIPKQTQPAKGEGASWSAVLRNLQQHYIQETPQRTKLTDVFLAFLLCNG
AVQFLYCVLAGNFPFNAFLAGFGATVGQFILTISLRIQTAESNKGNFTEVAFADYIVCSLVLHFFCVNFIN*
Coding >Ophun1|5506
ATGGCACCCAAGAAACCCGCCCGCGGCGACAACAACGCACCCTCCCCCGCCCGAAACGTCTCCTCCGGCACCGCA
ACGCCCATCCCCAAGCAGACGCAGCCCGCGAAAGGCGAGGGCGCCAGCTGGAGCGCCGTCCTGCGCAACCTCCAG
CAGCACTACATTCAGGAGACGCCGCAGCGCACCAAGCTTACCGATGTGTTTCTCGCCTTCTTGCTCTGCAACGGC
GCTGTCCAGTTTCTCTACTGCGTCTTGGCTGGCAACTTCCCCTTTAATGCCTTTCTCGCTGGCTTTGGAGCTACG
GTTGGACAGTTTATCTTGACAATATCACTGCGCATCCAGACGGCGGAGAGCAACAAGGGCAATTTCACCGAGGTG
GCATTCGCCGACTACATCGTTTGCAGCCTCGTCCTGCACTTCTTCTGCGTCAACTTCATCAACTAG
Transcript >Ophun1|5506
ATGGCACCCAAGAAACCCGCCCGCGGCGACAACAACGCACCCTCCCCCGCCCGAAACGTCTCCTCCGGCACCGCA
ACGCCCATCCCCAAGCAGACGCAGCCCGCGAAAGGCGAGGGCGCCAGCTGGAGCGCCGTCCTGCGCAACCTCCAG
CAGCACTACATTCAGGAGACGCCGCAGCGCACCAAGCTTACCGATGTGTTTCTCGCCTTCTTGCTCTGCAACGGC
GCTGTCCAGTTTCTCTACTGCGTCTTGGCTGGCAACTTCCCCTTTAATGCCTTTCTCGCTGGCTTTGGAGCTACG
GTTGGACAGTTTATCTTGACAATATCACTGCGCATCCAGACGGCGGAGAGCAACAAGGGCAATTTCACCGAGGTG
GCATTCGCCGACTACATCGTTTGCAGCCTCGTCCTGCACTTCTTCTGCGTCAACTTCATCAACTAG
Gene >Ophun1|5506
ATGGCACCCAAGAAACCCGCCCGCGGCGACAACAACGCACCCTCCCCCGCCCGAAACGTCTCCTCCGGCACCGCA
ACGCCCATCCCCAAGCAGACGCAGCCCGCGAAAGGCGAGGGCGCCAGCTGGAGCGCCGTCCTGCGCAACCTCCAG
CAGCACTACATTCAGGAGACGCCGCAGCGCACCAAGCTTACCGATGTGTTTCTCGCCTTCTTGCTCTGCAACGGC
GCTGTCCAGTTTCTCTACTGCGTCTTGGCTGGCAACTTCGTACGTGCCGATAGCGAAGAGCTTGGGCTTGCCTTT
GCCGGTGCTGACCCTCGCCAGCCCTTTAATGCCTTTCTCGCTGGCTTTGGAGCTACGGTTGGACAGTTTATCTTG
ACAAGTAGGGGCTATATGTCCAGTCGTTGCCGAAAGCTCGCTGACATGCGTCATAGTATCACTGCGCATCCAGAC
GGCGGAGAGCAACAAGGGCAATTTCACCGAGGTGTCTGCGGAAAGGCGAGTGCAAAATCCTTTTATTTCTTTCTG
AAACCGGACACTGGGTCTAACCAACGTCTTCTTCACAGGGCATTCGCCGACTACATCGTTTGCAGCCTCGTCCTG
CACTTCTTCTGCGTCAACTTCATCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail