Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5505
Gene name
LocationContig_549:2642..4466
Strand-
Gene length (bp)1824
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01920 Prefoldin_2 Prefoldin subunit 3.1E-23 188 283
PF03647 Tmemb_14 Transmembrane proteins 14C 1.6E-22 9 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTC9|PFD2_SCHPO Probable prefoldin subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.10 PE=3 SV=1 186 283 2.0E-28
sp|Q9UHV9|PFD2_HUMAN Prefoldin subunit 2 OS=Homo sapiens GN=PFDN2 PE=1 SV=1 204 283 1.0E-18
sp|A1A4P5|PFD2_BOVIN Prefoldin subunit 2 OS=Bos taurus GN=PFDN2 PE=2 SV=1 204 283 1.0E-18
sp|B0BN18|PFD2_RAT Prefoldin subunit 2 OS=Rattus norvegicus GN=Pfdn2 PE=2 SV=1 199 283 8.0E-18
sp|O70591|PFD2_MOUSE Prefoldin subunit 2 OS=Mus musculus GN=Pfdn2 PE=1 SV=2 204 283 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTC9|PFD2_SCHPO Probable prefoldin subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.10 PE=3 SV=1 186 283 2.0E-28
sp|Q9UHV9|PFD2_HUMAN Prefoldin subunit 2 OS=Homo sapiens GN=PFDN2 PE=1 SV=1 204 283 1.0E-18
sp|A1A4P5|PFD2_BOVIN Prefoldin subunit 2 OS=Bos taurus GN=PFDN2 PE=2 SV=1 204 283 1.0E-18
sp|B0BN18|PFD2_RAT Prefoldin subunit 2 OS=Rattus norvegicus GN=Pfdn2 PE=2 SV=1 199 283 8.0E-18
sp|O70591|PFD2_MOUSE Prefoldin subunit 2 OS=Mus musculus GN=Pfdn2 PE=1 SV=2 204 283 1.0E-17
sp|Q9LJ98|PFD2_ARATH Probable prefoldin subunit 2 OS=Arabidopsis thaliana GN=At3g22480 PE=2 SV=1 187 283 2.0E-17
sp|P47131|YJ55_YEAST TMEM14 protein homolog YJR085C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR085C PE=1 SV=1 5 104 4.0E-16
sp|Q9VTE5|PFD2_DROME Probable prefoldin subunit 2 OS=Drosophila melanogaster GN=l(3)01239 PE=2 SV=1 176 283 7.0E-14
sp|Q75JB5|TM14_DICDI Transmembrane protein 14 homolog OS=Dictyostelium discoideum GN=DDB_G0271790 PE=3 SV=1 11 99 7.0E-14
sp|Q55GN3|PFD2_DICDI Probable prefoldin subunit 2 OS=Dictyostelium discoideum GN=pfdn2 PE=3 SV=1 176 282 1.0E-13
sp|A8WVJ9|PFD2_CAEBR Prefoldin subunit 2 OS=Caenorhabditis briggsae GN=pfd-2 PE=3 SV=1 172 285 9.0E-11
sp|Q9P7G3|YK45_SCHPO TMEM14 protein homolog P14E8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP14E8.05c PE=3 SV=1 8 98 4.0E-10
sp|P40005|PFD2_YEAST Prefoldin subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM4 PE=1 SV=2 190 283 4.0E-10
sp|Q9N5M2|PFD2_CAEEL Prefoldin subunit 2 OS=Caenorhabditis elegans GN=pdf-2 PE=3 SV=1 194 284 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016272 prefoldin complex Yes
GO:0016020 membrane Yes
GO:0051082 unfolded protein binding Yes
GO:0006457 protein folding Yes
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0005515 protein binding No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 31 48 17
3 55 77 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5505
MPQQLEYSAYALAALTAGGGLMGFVRTRSKPSLIAGSAVGILYGIGGYRMQNKQPYGIELGLLASIILGGSSIPR
AIRIRKPVPIVLSILSTFGLLTFGNAYRETAGDLVHEALGVACLEGGDDVLAGWVAKPDQFRVPKFWIDGGLRLW
MYRASEPDHCTVFRNALHLSPLSGAMPAQQQAPAKKQQDLQTTYSTYKNTLQQMAQKIGDIEQEAEEHRLVLETL
EPLSEDRKCFRLINGVLVERTVKDVVPALKTNQEGLRKVLDDLVKQYKTKQDELDKWKVGRRRYPVGRL*
Coding >Ophun1|5505
ATGCCCCAGCAGCTGGAATACTCGGCCTACGCGCTGGCGGCGCTGACCGCTGGAGGTGGCCTCATGGGCTTCGTG
CGGACGCGTTCCAAGCCTTCGCTCATCGCGGGCTCGGCCGTCGGCATCCTCTACGGCATTGGCGGCTATCGTATG
CAGAATAAGCAGCCGTACGGCATCGAGTTGGGTCTTTTGGCGTCGATTATTCTCGGCGGGTCGTCGATCCCGCGC
GCGATTCGCATTAGGAAGCCTGTGCCCATTGTTCTCAGCATCTTGTCGACATTTGGCCTGCTCACGTTTGGGAAT
GCGTATCGAGAGACCGCCGGTGACCTTGTGCATGAAGCCTTGGGCGTGGCATGCCTCGAGGGCGGCGATGATGTC
CTCGCAGGCTGGGTGGCCAAGCCGGATCAGTTCCGGGTTCCGAAGTTTTGGATTGACGGTGGCCTCCGCCTCTGG
ATGTATCGAGCATCTGAACCAGACCACTGCACCGTCTTCCGAAACGCTCTCCATCTCTCGCCCCTCTCTGGAGCC
ATGCCGGCTCAACAGCAGGCTCCGGCCAAGAAACAACAGGACCTGCAGACGACGTACTCGACCTACAAAAACACG
CTTCAGCAGATGGCTCAGAAGATAGGAGATATTGAGCAAGAGGCCGAAGAGCACAGGCTTGTTTTAGAAACGTTG
GAACCGCTGTCTGAGGATCGCAAGTGCTTCCGATTGATCAATGGCGTGCTGGTGGAGAGGACGGTTAAGGATGTT
GTGCCTGCCCTCAAGACAAACCAGGAGGGGCTGAGAAAGGTGCTCGACGACCTTGTCAAGCAGTACAAGACGAAG
CAGGACGAGCTGGACAAGTGGAAGGTTGGTCGACGACGCTACCCTGTTGGCCGGCTGTGA
Transcript >Ophun1|5505
ATGCCCCAGCAGCTGGAATACTCGGCCTACGCGCTGGCGGCGCTGACCGCTGGAGGTGGCCTCATGGGCTTCGTG
CGGACGCGTTCCAAGCCTTCGCTCATCGCGGGCTCGGCCGTCGGCATCCTCTACGGCATTGGCGGCTATCGTATG
CAGAATAAGCAGCCGTACGGCATCGAGTTGGGTCTTTTGGCGTCGATTATTCTCGGCGGGTCGTCGATCCCGCGC
GCGATTCGCATTAGGAAGCCTGTGCCCATTGTTCTCAGCATCTTGTCGACATTTGGCCTGCTCACGTTTGGGAAT
GCGTATCGAGAGACCGCCGGTGACCTTGTGCATGAAGCCTTGGGCGTGGCATGCCTCGAGGGCGGCGATGATGTC
CTCGCAGGCTGGGTGGCCAAGCCGGATCAGTTCCGGGTTCCGAAGTTTTGGATTGACGGTGGCCTCCGCCTCTGG
ATGTATCGAGCATCTGAACCAGACCACTGCACCGTCTTCCGAAACGCTCTCCATCTCTCGCCCCTCTCTGGAGCC
ATGCCGGCTCAACAGCAGGCTCCGGCCAAGAAACAACAGGACCTGCAGACGACGTACTCGACCTACAAAAACACG
CTTCAGCAGATGGCTCAGAAGATAGGAGATATTGAGCAAGAGGCCGAAGAGCACAGGCTTGTTTTAGAAACGTTG
GAACCGCTGTCTGAGGATCGCAAGTGCTTCCGATTGATCAATGGCGTGCTGGTGGAGAGGACGGTTAAGGATGTT
GTGCCTGCCCTCAAGACAAACCAGGAGGGGCTGAGAAAGGTGCTCGACGACCTTGTCAAGCAGTACAAGACGAAG
CAGGACGAGCTGGACAAGTGGAAGGTTGGTCGACGACGCTACCCTGTTGGCCGGCTGTGA
Gene >Ophun1|5505
ATGGTAGGCCAGCATCTTCAGCCGAGCGCATCCGGCCAGGAGTGCATAGCTAGCTAACACGCCGCGCCGCAAGCC
CCAGCAGCTGGAATACTCGGCCTACGCGCTGGCGGCGCTGACCGCTGGAGGTGGCCTCATGGGCTTCGTGCGGAC
GCGTTCCAAGCCTTCGCTCATCGCGGGCTCGGCCGTCGGCATCCTCTGTACGTCCGGCCCTTCACCTCCTTGCGC
TACGACGCTCTTTCTAATGTGTGGATTTGTGAAAGACGGCATTGGCGGCTATCGTATGCAGAATAAGCAGCCGTA
CGGCATCGAGTTGGGTCTTTTGGCGTCGATTATTCTCGGCGGGTCGTCGATCCCGCGCGCGATTCGCATTAGGAA
GCCTGTGCCCATTGTTCTCAGCATCTTGTCGACATTTGGCCTGCTCACGTTTGGGAATGCGTATCGAGAGAGTCT
GTGATTGCTCGAGGGGATTGGTGTATGTATGTAGCGAGGAGCAGGGTAAAAGTTGGTACGCCGGACTCGACGTTT
CAATTCGTCTGTTGGTGGTATCTGAGAGACAGGAGTGATTTCATTTCTGGCGGTTTCGAAGCACCGATGAGCTTT
CCCGCGAGACGCAAAACGCCGATAAACCCTCTAAGCTCCCCCCACGACTCAGAGACCCAGGTTCTTCCGTTCCTC
CTCCAGCCGTTTGCGCTTTTCCTTGGCGGCGGCTCTGTTGTCTGCCTGTAACCTTGCTCGTTCCTCACGTAGACA
CTTGTTGACCTGCGTCTTGATTTCGTTGCAGCCGCCGGTGACCTTGTGCATGAAGCCTTGGGCGTGGCATGCCTC
GAGGGCGGCGATGATGTCCTCGCAGGCTGGGTGGCCAAGCCGGATCAGTTCCGGGTTCCGAAGTTTTGGATTGAC
GGTGGGTGAGCATGTTACCTAGAGCATTCTTGTTATGGAGATGGGGATGCATGTCGCTTGTCTTTCAGCCTCCGC
CTCTGGATGTATCGAGCATCTGGTGAGGCCGTGGCTCCGTTGAGGTTGTCGTTCGTGGACCCTCTTTAATTGGTT
AGGTAAGGCAGTCAGAAGCTCTACACTGTGCTGCTTGCGTTGACAAGGTGAGAAAAGACAGTGTCACCGTAGCAG
CATCACACGGCCGCTGTTATCAAAACCCGTCTGCACTTCCAACCCTCCAGAACCAGACCACTGCACCGTCTTCCG
AAACGCTCTCCATCTCTCGCCCCTCTCTGGAGCCATGCCGGCTCAACAGCAGGCTCCGGCCAAGAAACAACAGGG
TTCGTTCGCCGAGCGGTTCGGGGAACTGGAGCTGCCCCCCCCGCTCTCTACGTGCGACTGATTGTGTGTCTCGGC
AGACCTGCAGACGACGTACTCGACCTACAAAAACACGCTTCAGCAGATGGCTCAGAAGATAGGAGATATTGAGCA
AGAGGCCGAAGAGCACAGGTTTGTCGCCGCATGATTCTGATGTTTCTCCCCCCTTTCCCCCTTCCCCTCCATCCT
ATATAATCGGGATGGAGGGGAGCGGTGTCTGGCTGGCGATGCTGCCCAACTGTCGCGCCATGCAGAACCAGAGTG
CTCGTCTGACAACGTGTCAGGCTTGTTTTAGAAACGTTGGAACCGCTGTCTGAGGATCGCAAGTGCTTCCGATTG
ATCAATGGCGTGCTGGTGGAGAGGACGGTTAAGGATGTTGTGCCTGCCCTCAAGACAAACCAGGAGGGGCTGAGA
AAGGTGCTCGACGACCTTGTCAAGCAGTACAAGACGAAGCAGGACGAGCTGGACAAGTGGAAGGTTGGTCGACGA
CGCTACCCTGTTGGCCGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail