Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5499
Gene name
LocationContig_547:10790..12569
Strand-
Gene length (bp)1779
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 1 514 2.0E-51
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 8 425 2.0E-49
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 182 493 1.0E-38
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 7 506 1.0E-30
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 7 506 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 1 514 2.0E-51
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 8 425 2.0E-49
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 182 493 1.0E-38
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 7 506 1.0E-30
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 7 506 1.0E-30
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 2 510 2.0E-27
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 38 437 1.0E-20
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 190 506 6.0E-20
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 4 437 3.0E-18
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 11 419 1.0E-06
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 16 181 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 123 145 22
3 155 177 22
4 189 211 22
5 226 244 18
6 265 287 22
7 302 324 22
8 329 347 18
9 360 382 22
10 466 488 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5499
MEPDAPSSFFQKKAPGVRRVEALVAVMTWRDKARIMASIFVIATVIHINNVLRGAIITRKTNIMKVHGMQAPILI
ARAITAASTLPPAARLADVMGRRSLVWLSLATFVSGTLLETFSARLKLYVLGNALSQMGFTVMGLFMELLIANIS
STRSRIVYSLVPVLPIILATFVSGVLVECLRYIRLCGDVFWVLDIVGAALIATIMFLVLLPPQFAGGIVPRWTER
AIYVPMMVGAGLIPVFILWEYQTSHPLIPLPLMRQRSIWAALGLALFANFTHAVQSNHLYVYVHYMLGRPNREAT
IISSLDATTSAMVGMVIGIVVMYVRRLKVFVICGTLVYFVANWLVFYSRYWATKDVEPAIIGAQILLGVAIGLFP
YPALTSLQAGVNQDHLAIVTSFYSAQYQVGNALGHAVAGVIWTQLVPSRLVDMLGYQHGTQAALELAAMMPSEES
TGSGLAWAARRAYRSVFLYNYIAAVALAAPVVIFGLLISDQKLNHHQSLVETLPHECDKETTEQACA*
Coding >Ophun1|5499
ATGGAGCCAGACGCACCGAGCTCGTTCTTCCAGAAAAAAGCGCCCGGCGTCCGTCGCGTCGAAGCCCTGGTCGCC
GTTATGACCTGGAGGGATAAAGCGCGCATCATGGCCTCCATCTTCGTCATCGCTACCGTCATCCACATCAACAAC
GTGCTTCGCGGCGCCATCATCACGCGAAAGACGAATATCATGAAGGTTCATGGCATGCAGGCTCCCATCCTCATC
GCTAGGGCTATCACTGCGGCTTCCACCTTGCCCCCTGCGGCGAGGCTGGCGGATGTCATGGGGAGGAGGTCGCTT
GTCTGGCTTTCTCTGGCGACGTTCGTCAGCGGGACGTTACTGGAGACGTTTTCGGCGAGACTGAAGCTGTATGTC
TTGGGCAACGCGCTTTCGCAGATGGGCTTTACCGTCATGGGCCTTTTCATGGAGCTGCTCATCGCCAACATCTCT
TCGACGCGGTCTCGGATCGTCTACAGTCTTGTTCCCGTCTTGCCCATCATACTCGCTACCTTTGTGTCTGGAGTG
TTGGTTGAGTGTCTTCGGTATATCCGCCTCTGCGGCGACGTCTTCTGGGTTCTCGACATCGTGGGAGCCGCCCTC
ATCGCTACCATCATGTTTCTCGTCTTATTACCTCCTCAGTTCGCAGGAGGCATCGTCCCTCGCTGGACGGAACGC
GCCATCTACGTGCCCATGATGGTCGGCGCTGGCCTGATCCCCGTCTTCATCCTTTGGGAGTACCAGACGAGTCAT
CCGCTGATTCCCCTTCCGCTGATGCGCCAGCGTTCCATCTGGGCGGCGCTGGGACTCGCCTTGTTCGCCAACTTC
ACTCACGCGGTGCAGAGCAATCACCTGTACGTCTATGTCCACTACATGCTGGGTCGGCCCAATCGAGAAGCGACC
ATCATCAGCAGTCTCGATGCTACGACCAGCGCCATGGTGGGAATGGTTATCGGCATTGTCGTCATGTACGTTCGA
CGGCTCAAGGTCTTCGTCATCTGCGGAACTCTTGTCTACTTCGTGGCCAACTGGCTCGTCTTCTACTCGCGATAC
TGGGCAACTAAAGACGTCGAACCCGCCATCATCGGCGCTCAGATTCTTCTCGGCGTTGCCATCGGCCTGTTCCCC
TATCCGGCCCTGACGTCTCTTCAGGCCGGCGTCAACCAGGACCATCTGGCCATCGTGACGAGCTTCTACTCGGCC
CAGTACCAAGTCGGGAATGCGCTGGGACATGCTGTCGCCGGCGTCATCTGGACACAGCTTGTGCCGTCCAGACTC
GTCGACATGCTGGGCTACCAGCATGGCACTCAGGCCGCGCTCGAACTGGCTGCCATGATGCCGAGTGAGGAGTCG
ACGGGCTCGGGATTGGCTTGGGCCGCTCGTCGGGCATATCGTTCCGTCTTTCTCTACAATTACATCGCGGCTGTT
GCCCTGGCCGCTCCCGTTGTCATCTTTGGGCTATTGATCAGCGATCAGAAGCTCAATCATCACCAATCCTTGGTC
GAGACGCTGCCGCACGAGTGTGACAAGGAAACGACCGAACAAGCTTGTGCATGA
Transcript >Ophun1|5499
ATGGAGCCAGACGCACCGAGCTCGTTCTTCCAGAAAAAAGCGCCCGGCGTCCGTCGCGTCGAAGCCCTGGTCGCC
GTTATGACCTGGAGGGATAAAGCGCGCATCATGGCCTCCATCTTCGTCATCGCTACCGTCATCCACATCAACAAC
GTGCTTCGCGGCGCCATCATCACGCGAAAGACGAATATCATGAAGGTTCATGGCATGCAGGCTCCCATCCTCATC
GCTAGGGCTATCACTGCGGCTTCCACCTTGCCCCCTGCGGCGAGGCTGGCGGATGTCATGGGGAGGAGGTCGCTT
GTCTGGCTTTCTCTGGCGACGTTCGTCAGCGGGACGTTACTGGAGACGTTTTCGGCGAGACTGAAGCTGTATGTC
TTGGGCAACGCGCTTTCGCAGATGGGCTTTACCGTCATGGGCCTTTTCATGGAGCTGCTCATCGCCAACATCTCT
TCGACGCGGTCTCGGATCGTCTACAGTCTTGTTCCCGTCTTGCCCATCATACTCGCTACCTTTGTGTCTGGAGTG
TTGGTTGAGTGTCTTCGGTATATCCGCCTCTGCGGCGACGTCTTCTGGGTTCTCGACATCGTGGGAGCCGCCCTC
ATCGCTACCATCATGTTTCTCGTCTTATTACCTCCTCAGTTCGCAGGAGGCATCGTCCCTCGCTGGACGGAACGC
GCCATCTACGTGCCCATGATGGTCGGCGCTGGCCTGATCCCCGTCTTCATCCTTTGGGAGTACCAGACGAGTCAT
CCGCTGATTCCCCTTCCGCTGATGCGCCAGCGTTCCATCTGGGCGGCGCTGGGACTCGCCTTGTTCGCCAACTTC
ACTCACGCGGTGCAGAGCAATCACCTGTACGTCTATGTCCACTACATGCTGGGTCGGCCCAATCGAGAAGCGACC
ATCATCAGCAGTCTCGATGCTACGACCAGCGCCATGGTGGGAATGGTTATCGGCATTGTCGTCATGTACGTTCGA
CGGCTCAAGGTCTTCGTCATCTGCGGAACTCTTGTCTACTTCGTGGCCAACTGGCTCGTCTTCTACTCGCGATAC
TGGGCAACTAAAGACGTCGAACCCGCCATCATCGGCGCTCAGATTCTTCTCGGCGTTGCCATCGGCCTGTTCCCC
TATCCGGCCCTGACGTCTCTTCAGGCCGGCGTCAACCAGGACCATCTGGCCATCGTGACGAGCTTCTACTCGGCC
CAGTACCAAGTCGGGAATGCGCTGGGACATGCTGTCGCCGGCGTCATCTGGACACAGCTTGTGCCGTCCAGACTC
GTCGACATGCTGGGCTACCAGCATGGCACTCAGGCCGCGCTCGAACTGGCTGCCATGATGCCGAGTGAGGAGTCG
ACGGGCTCGGGATTGGCTTGGGCCGCTCGTCGGGCATATCGTTCCGTCTTTCTCTACAATTACATCGCGGCTGTT
GCCCTGGCCGCTCCCGTTGTCATCTTTGGGCTATTGATCAGCGATCAGAAGCTCAATCATCACCAATCCTTGGTC
GAGACGCTGCCGCACGAGTGTGACAAGGAAACGACCGAACAAGCTTGTGCATGA
Gene >Ophun1|5499
ATGGAGCCAGACGCACCGAGCTCGTTCTTCCAGAAAAAAGCGCCCGGCGTCCGTCGCGTCGAAGCCCTGGTCGCC
GTTATGACCTGGAGGGATAAAGCGCGCATCATGGCCTCCATCTTCGTCATCGCTACCGTCATCCACATCAACAAC
GTGCTTCGCGGCGCCATCATCACGCGAAAGACGAATATCATGAAGGTTCATGGCATGCAGGCTCCCATCCTCATC
GCTAGGGCTATCACTGCGGCTTCCACCTTGCCCCCTGCGGCGAGGCTGGCGGATGTCATGGGGAGGAGGTCGCTT
GTCTGGCTTTCTCTGGCGACGTTCGTCAGCGGGACGTTACTGGAGACGTTTTCGGCGAGACTGAAGCTGTATGTC
TTGGGCAACGCGCTTTCGCAGATGGGCTTTACCGTCATGGGCCTTTTCATGGAGCTGCTCATCGCCAACATCTCT
TCGACGCGGTCTCGGATCGTCTACAGTCTTGTTCCCGTCTTGCCCATCATACTCGCTACCTTTGTGTCTGGAGTG
TTGGTTGAGGTGCTTCTTGCTGATGGGTTTCCCTTGGGCTTGACTATTAGCATGTGGTGCTTCATCTTTCCGCTT
TGCACGCTGCCTTTGATGATGAGCTTGGTGGCCGTTGCCCGTCGGAGAAACGAGAGGGAAAGTTCCTGCTCTGGA
TCAACACCGTCACGTTCATCACATGAATCTTCACCGTCATCGACATCGACATCGACATGGACATCGATATCGGCT
TCATCCCAGTGTCTTCGGTATATCCGCCTCTGCGGCGACGTCTTCTGGGTTCTCGACATCGTGGGAGCCGCCCTC
ATCGCTACCATCATGTTTCTCGTCTTATTACCTCCTCAGTTCGCAGGAGGCATCGTCCCTCGCTGGACGGAACGC
GCCATCTACGTGCCCATGATGGTCGGCGCTGGCCTGATCCCCGTCTTCATCCTTTGGGAGTACCAGACGAGTCAT
CCGCTGATTCCCCTTCCGCTGATGCGCCAGCGTTCCATCTGGGCGGCGCTGGGACTCGCCTTGTTCGCCAACTTC
ACTCACGCGGTGCAGAGCAATCACCTGTACGTCTATGTCCACTACATGCTGGGTCGGCCCAATCGAGAAGCGACC
ATCATCAGCAGTCTCGATGCTACGACCAGCGCCATGGTGGGAATGGTTATCGGCATTGTCGTCATGTACGTTCGA
CGGCTCAAGGTCTTCGTCATCTGCGGAACTCTTGTCTACTTCGTGGCCAACTGGCTCGTCTTCTACTCGCGATAC
TGGGCAACTAAAGACGTCGAACCCGCCATCATCGGCGCTCAGATTCTTCTCGGCGTTGCCATCGGCCTGTTCCCC
TATCCGGCCCTGACGTCTCTTCAGGCCGGCGTCAACCAGGACCATCTGGCCATCGTGACGAGCTTCTACTCGGCC
CAGTACCAAGTCGGGAATGCGCTGGGACATGCTGTCGCCGGCGTCATCTGGACACAGCTTGTGCCGTCCAGACTC
GTCGACATGCTGGGCTACCAGCATGGCACTCAGGCCGCGCTCGAACTGGCTGCCATGATGCCGAGTGAGGAGTCG
ACGGGCTCGGGATTGGCTTGGGCCGCTCGTCGGGCATATCGTTCCGTCTTTCTCTACAATTACATCGCGGCTGTT
GCCCTGGCCGCTCCCGTTGTCATCTTTGGGCTATTGATCAGCGATCAGAAGCTCAATCATCACCAATCCTTGGTC
GAGACGCTGCCGCACGAGTGTGACAAGGAAACGACCGAACAAGCTTGTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail