Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5496
Gene name
LocationContig_547:1469..3617
Strand-
Gene length (bp)2148
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain 5.8E-12 117 223
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 5.6E-08 236 318
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 4.9E-07 360 483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4FAT7|BGLR_PIG Beta-glucuronidase OS=Sus scrofa GN=GUSB PE=3 SV=1 55 506 4.0E-22
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 28 473 1.0E-19
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 71 480 2.0E-18
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 46 473 1.0E-17
sp|O77695|BGLR_CHLAE Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops GN=GUSB PE=2 SV=1 58 473 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4FAT7|BGLR_PIG Beta-glucuronidase OS=Sus scrofa GN=GUSB PE=3 SV=1 55 506 4.0E-22
sp|O97524|BGLR_FELCA Beta-glucuronidase OS=Felis catus GN=GUSB PE=1 SV=1 28 473 1.0E-19
sp|P06760|BGLR_RAT Beta-glucuronidase OS=Rattus norvegicus GN=Gusb PE=2 SV=1 71 480 2.0E-18
sp|O18835|BGLR_CANLF Beta-glucuronidase OS=Canis lupus familiaris GN=GUSB PE=1 SV=1 46 473 1.0E-17
sp|O77695|BGLR_CHLAE Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops GN=GUSB PE=2 SV=1 58 473 3.0E-17
sp|P12265|BGLR_MOUSE Beta-glucuronidase OS=Mus musculus GN=Gusb PE=1 SV=2 70 480 6.0E-17
sp|P08236|BGLR_HUMAN Beta-glucuronidase OS=Homo sapiens GN=GUSB PE=1 SV=2 46 480 1.0E-16
sp|Q5R5N6|BGLR_PONAB Beta-glucuronidase OS=Pongo abelii GN=GUSB PE=2 SV=2 55 480 2.0E-16
sp|P77989|BGAL_THEP3 Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lacZ PE=3 SV=2 121 442 5.0E-16
sp|Q56307|BGAL_THEMA Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lacZ PE=3 SV=2 119 448 9.0E-16
sp|P05804|BGLR_ECOLI Beta-glucuronidase OS=Escherichia coli (strain K12) GN=uidA PE=1 SV=2 70 475 1.0E-15
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 121 447 1.0E-14
sp|P26257|BGAL_THETU Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes GN=lacZ PE=1 SV=1 138 442 1.0E-14
sp|A1SWB8|BGAL_PSYIN Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) GN=lacZ PE=3 SV=1 122 469 4.0E-13
sp|Q48727|BGAL_LACLA Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacZ PE=3 SV=3 126 480 4.0E-12
sp|Q5B7W2|MANBB_EMENI Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndB PE=1 SV=2 69 454 4.0E-10
sp|A4W7D2|BGAL_ENT38 Beta-galactosidase OS=Enterobacter sp. (strain 638) GN=lacZ PE=3 SV=1 122 469 4.0E-09
sp|O33815|BGAL_STAXY Beta-galactosidase OS=Staphylococcus xylosus GN=lacZ PE=3 SV=1 140 469 7.0E-09
sp|A8GGN3|BGAL_SERP5 Beta-galactosidase OS=Serratia proteamaculans (strain 568) GN=lacZ PE=3 SV=1 122 469 8.0E-09
sp|B5XQY2|BGAL_KLEP3 Beta-galactosidase OS=Klebsiella pneumoniae (strain 342) GN=lacZ PE=3 SV=1 126 450 1.0E-08
sp|B2VHN8|BGAL_ERWT9 Beta-galactosidase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lacZ PE=3 SV=1 256 447 1.0E-08
sp|A3FEW8|BGAL_ENTAG Beta-galactosidase OS=Enterobacter agglomerans GN=lacZ PE=1 SV=2 122 469 1.0E-08
sp|A5F5U6|BGAL_VIBC3 Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=lacZ PE=3 SV=2 135 469 2.0E-08
sp|A6T8X0|BGAL1_KLEP7 Beta-galactosidase 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lacZ1 PE=3 SV=1 126 450 2.0E-08
sp|P06219|BGAL1_KLEPN Beta-galactosidase OS=Klebsiella pneumoniae GN=lacZ PE=3 SV=1 126 450 4.0E-08
sp|P0C1Y0|BGAL_LACDE Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=lacZ PE=1 SV=2 214 474 1.0E-07
sp|Q1G9Z4|BGAL_LACDA Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lacZ PE=3 SV=3 214 474 1.0E-07
sp|Q9K9C6|BGAL_BACHD Beta-galactosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lacZ PE=3 SV=1 69 403 1.0E-07
sp|P81650|BGAL_PSEHA Beta-galactosidase OS=Pseudoalteromonas haloplanktis GN=lacZ PE=1 SV=2 255 469 2.0E-07
sp|Q2XQU3|BGAL2_ENTCL Beta-galactosidase 2 OS=Enterobacter cloacae GN=lacZ PE=3 SV=1 122 469 3.0E-07
sp|Q6LL68|BGAL_PHOPR Beta-galactosidase OS=Photobacterium profundum GN=lacZ PE=3 SV=1 134 469 6.0E-07
sp|Q03WL0|BGAL_LEUMM Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=lacZ PE=3 SV=1 142 469 8.0E-07
sp|Q8D4H3|BGAL_VIBVU Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) GN=lacZ PE=3 SV=2 273 469 9.0E-07
sp|O52847|BGAL_BACMD Beta-galactosidase OS=Bacillus megaterium (strain DSM 319) GN=bgaM PE=3 SV=1 138 475 3.0E-06
sp|Q7MG04|BGAL_VIBVY Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) GN=lacZ PE=3 SV=1 283 469 4.0E-06
sp|Q04F24|BGAL_OENOB Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=lacZ PE=3 SV=1 276 469 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.999674

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH2 3.7E-96 64 496

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4559
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7657
Ophiocordyceps australis map64 (Brazil) OphauB2|554
Ophiocordyceps camponoti-floridani Ophcf2|06300
Ophiocordyceps camponoti-rufipedis Ophun1|5496 (this protein)
Ophiocordyceps kimflemingae Ophio5|7311
Ophiocordyceps subramaniannii Hirsu2|954

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5496
MERLSRFLLLPLLLLCQPGQTASSQALLKRAPTPYRAQTPPLDTPWTAKVGTNPWPEHPRPQLRRDAWHSLNGLW
TYRDAGTRTPRDGLPEAGPLDREVLIPSCIESALSGIQQLNTSRVWFETPFRVPGGWNGTSRVLLHFEAVDYEAT
VFLDGVEVGRHVGGYFRFSIDLTGKVRAGEEHRLLVYVFDPTDTDVIPVGKQTKNPRHIWYRPCTGIWQTVWLES
VASSDYISQLDVSADMTGLVTVQAHSSGRKGTPVEVTIIDSDGRPLCKGTGKADSKFSFKVQAPKLWSPSTPHLY
NVSVVMGRDVVHSYTGFRTISTGVVKGVQRPLLNGEFVFLFGTLDQGFWPDGLYTPPTREAMVYDLKMLKDLGFN
MVRKHIKVEPDLFYRACDEMGLMVIQDMPSLPDDQSRPPNDAQQAQFQRQLEILINEHKSYPSIVTWLIYNEGWG
QRRQAPFPEGKLTDVVRGIDSTRLIDSASGWVDHGFGDFSDNHHYANPQCGSPFYSLASPPYDAKRIGFQGEFGG
IGHTPTIEHLWNVRQAIDTVNETYEINADLEAYNYRAGVLFRELREQVERYACSGGVWTQTTDVEGEVNGLYTYD
RRVLRPDVGQWRGDIRRLYEAAARRAR*
Coding >Ophun1|5496
ATGGAGCGTCTATCCCGCTTCCTGCTGCTCCCCCTGCTACTCCTCTGTCAACCGGGCCAGACAGCGTCATCACAA
GCTCTCCTCAAGCGCGCCCCAACCCCCTACCGAGCGCAGACACCGCCCCTCGACACGCCCTGGACAGCAAAAGTC
GGGACAAATCCCTGGCCAGAGCATCCACGACCGCAACTCCGCCGCGACGCCTGGCATAGCCTCAACGGGCTGTGG
ACGTACCGCGATGCCGGCACCCGGACGCCGAGAGATGGCCTTCCGGAGGCGGGGCCGCTGGATCGTGAGGTGTTG
ATCCCTTCGTGTATTGAGAGTGCGCTTTCGGGCATCCAGCAGCTTAATACCTCGCGGGTCTGGTTCGAGACGCCT
TTTCGAGTGCCGGGAGGGTGGAATGGGACGAGTAGGGTTTTGTTGCACTTTGAGGCTGTTGACTACGAGGCTACT
GTTTTCCTGGATGGGGTTGAGGTTGGGAGACATGTTGGGGGGTATTTCCGATTCAGCATCGATTTGACCGGCAAG
GTTAGGGCTGGAGAGGAGCACAGACTTCTCGTCTACGTCTTTGATCCGACGGACACGGATGTCATACCCGTTGGG
AAGCAGACCAAGAACCCTCGTCATATCTGGTATCGTCCTTGTACGGGAATCTGGCAGACTGTCTGGCTGGAGAGC
GTTGCGTCGTCGGATTACATCTCTCAGCTCGACGTCTCAGCCGACATGACAGGTCTAGTCACAGTCCAAGCCCAC
AGCTCAGGACGAAAGGGAACCCCCGTCGAGGTAACCATCATAGACTCAGACGGCAGACCCCTCTGCAAGGGCACC
GGAAAGGCAGACTCGAAATTCAGCTTCAAGGTCCAGGCGCCGAAGCTGTGGAGTCCGTCGACGCCTCACCTGTAC
AACGTCAGCGTCGTCATGGGCAGGGACGTGGTGCACAGCTATACTGGCTTCCGGACGATTTCTACGGGGGTGGTC
AAGGGGGTGCAGAGGCCGTTGCTTAACGGCGAGTTTGTGTTTTTGTTTGGCACGCTTGATCAGGGGTTTTGGCCG
GATGGGTTGTATACGCCTCCTACTCGGGAGGCTATGGTTTATGACCTGAAGATGCTGAAGGATCTGGGCTTTAAC
ATGGTCAGGAAGCACATCAAAGTTGAACCGGATCTGTTCTACCGAGCCTGCGATGAGATGGGCTTAATGGTCATC
CAAGACATGCCCAGCCTCCCCGACGACCAAAGCCGCCCCCCCAACGACGCCCAACAAGCCCAGTTCCAGCGCCAG
CTCGAGATTCTAATCAACGAGCATAAGAGCTACCCCTCCATCGTCACCTGGCTGATCTACAACGAGGGTTGGGGA
CAGCGTCGTCAGGCTCCGTTCCCAGAAGGCAAGCTCACTGACGTTGTTCGCGGGATTGATTCGACGAGGTTGATT
GACTCTGCTTCTGGATGGGTGGATCATGGCTTTGGTGATTTCTCGGATAACCATCACTACGCTAATCCTCAGTGC
GGCTCGCCCTTTTACTCCCTCGCTTCTCCGCCCTACGACGCGAAACGGATTGGCTTCCAGGGTGAATTCGGAGGC
ATAGGCCACACCCCAACAATAGAGCATCTCTGGAACGTGCGCCAAGCCATCGACACGGTCAACGAAACGTACGAG
ATCAACGCCGACTTGGAAGCCTACAACTACCGCGCGGGCGTGCTGTTCCGCGAGTTGCGCGAGCAGGTCGAGCGC
TATGCTTGCAGCGGCGGCGTGTGGACGCAGACTACGGATGTCGAGGGCGAGGTCAATGGCTTGTATACTTATGAT
CGGAGGGTTTTGAGGCCGGATGTTGGGCAGTGGAGGGGGGATATTCGGCGGTTGTATGAGGCTGCTGCTAGGAGG
GCGAGGTAG
Transcript >Ophun1|5496
ATGGAGCGTCTATCCCGCTTCCTGCTGCTCCCCCTGCTACTCCTCTGTCAACCGGGCCAGACAGCGTCATCACAA
GCTCTCCTCAAGCGCGCCCCAACCCCCTACCGAGCGCAGACACCGCCCCTCGACACGCCCTGGACAGCAAAAGTC
GGGACAAATCCCTGGCCAGAGCATCCACGACCGCAACTCCGCCGCGACGCCTGGCATAGCCTCAACGGGCTGTGG
ACGTACCGCGATGCCGGCACCCGGACGCCGAGAGATGGCCTTCCGGAGGCGGGGCCGCTGGATCGTGAGGTGTTG
ATCCCTTCGTGTATTGAGAGTGCGCTTTCGGGCATCCAGCAGCTTAATACCTCGCGGGTCTGGTTCGAGACGCCT
TTTCGAGTGCCGGGAGGGTGGAATGGGACGAGTAGGGTTTTGTTGCACTTTGAGGCTGTTGACTACGAGGCTACT
GTTTTCCTGGATGGGGTTGAGGTTGGGAGACATGTTGGGGGGTATTTCCGATTCAGCATCGATTTGACCGGCAAG
GTTAGGGCTGGAGAGGAGCACAGACTTCTCGTCTACGTCTTTGATCCGACGGACACGGATGTCATACCCGTTGGG
AAGCAGACCAAGAACCCTCGTCATATCTGGTATCGTCCTTGTACGGGAATCTGGCAGACTGTCTGGCTGGAGAGC
GTTGCGTCGTCGGATTACATCTCTCAGCTCGACGTCTCAGCCGACATGACAGGTCTAGTCACAGTCCAAGCCCAC
AGCTCAGGACGAAAGGGAACCCCCGTCGAGGTAACCATCATAGACTCAGACGGCAGACCCCTCTGCAAGGGCACC
GGAAAGGCAGACTCGAAATTCAGCTTCAAGGTCCAGGCGCCGAAGCTGTGGAGTCCGTCGACGCCTCACCTGTAC
AACGTCAGCGTCGTCATGGGCAGGGACGTGGTGCACAGCTATACTGGCTTCCGGACGATTTCTACGGGGGTGGTC
AAGGGGGTGCAGAGGCCGTTGCTTAACGGCGAGTTTGTGTTTTTGTTTGGCACGCTTGATCAGGGGTTTTGGCCG
GATGGGTTGTATACGCCTCCTACTCGGGAGGCTATGGTTTATGACCTGAAGATGCTGAAGGATCTGGGCTTTAAC
ATGGTCAGGAAGCACATCAAAGTTGAACCGGATCTGTTCTACCGAGCCTGCGATGAGATGGGCTTAATGGTCATC
CAAGACATGCCCAGCCTCCCCGACGACCAAAGCCGCCCCCCCAACGACGCCCAACAAGCCCAGTTCCAGCGCCAG
CTCGAGATTCTAATCAACGAGCATAAGAGCTACCCCTCCATCGTCACCTGGCTGATCTACAACGAGGGTTGGGGA
CAGCGTCGTCAGGCTCCGTTCCCAGAAGGCAAGCTCACTGACGTTGTTCGCGGGATTGATTCGACGAGGTTGATT
GACTCTGCTTCTGGATGGGTGGATCATGGCTTTGGTGATTTCTCGGATAACCATCACTACGCTAATCCTCAGTGC
GGCTCGCCCTTTTACTCCCTCGCTTCTCCGCCCTACGACGCGAAACGGATTGGCTTCCAGGGTGAATTCGGAGGC
ATAGGCCACACCCCAACAATAGAGCATCTCTGGAACGTGCGCCAAGCCATCGACACGGTCAACGAAACGTACGAG
ATCAACGCCGACTTGGAAGCCTACAACTACCGCGCGGGCGTGCTGTTCCGCGAGTTGCGCGAGCAGGTCGAGCGC
TATGCTTGCAGCGGCGGCGTGTGGACGCAGACTACGGATGTCGAGGGCGAGGTCAATGGCTTGTATACTTATGAT
CGGAGGGTTTTGAGGCCGGATGTTGGGCAGTGGAGGGGGGATATTCGGCGGTTGTATGAGGCTGCTGCTAGGAGG
GCGAGGTAG
Gene >Ophun1|5496
ATGGAGCGTCTATCCCGCTTCCTGCTGCTCCCCCTGCTACTCCTCTGTCAACCGGGCCAGACAGCGTCATCACAA
GCTCTCCTCAAGCGCGCCCCAACCCCCTACCGAGCGCAGACACCGCCCCTCGACACGCCCTGGACAGCAAAAGTC
GGGACAAATCCCTGGCCAGAGCATCCACGACCGCAACTCCGCCGCGACGCCTGGCATAGCCTCAACGGGCTGTGG
ACGTACCGCGATGCCGGCACCCGGACGCCGAGAGATGGCCTTCCGGAGGCGGGGCCGCTGGATCGTGAGGTGTTG
ATCCCTTCGTGTATTGAGAGTGCGCTTTCGGGCATCCAGCAGCTTAATACCTCGCGGGTCTGGTTCGAGACGCCT
TTTCGAGTGCCGGGAGGGTGGAATGGGACGAGTAGGGTTTTGTTGCACTTTGAGGCTGTTGACTACGAGGCTACT
GTTTTCCTGGATGGGGTTGAGGTTGGGAGACATGTTGGGGGGTATTTCCGATTCAGCATCGATTTGACCGGCAAG
GTTAGGGCTGGAGAGGAGCACAGACTGTGAGTGTTTTCTTTTGTCGATGCTGAAGAGGGTCATGGCTAACACGGT
ATAGTCTCGTCTACGTCTTTGATCCGACGGACACGGATGTCATACCCGTTGGGAAGCAGACCAAGAACCCTCGTC
ATATCTGGTATCGTCCTTGTACGGGAATCTGGCAGACTGTCTGGCTGGAGAGCGTTGCGTCGTCGGATTACATCT
CTCAGCTCGACGTCTCAGCCGACATGACAGGTCTAGTCACAGTCCAAGCCCACAGCTCAGGACGAAAGGGAACCC
CCGTCGAGGTAACCATCATAGACTCAGACGGCAGACCCCTCTGCAAGGGCACCGGAAAGGCAGACTCGAAATTCA
GCTTCAAGGTCCAGGCGCCGAAGCTGTGGAGTCCGTCGACGCCTCACCTGTACAACGTCAGCGTCGTCATGGGCA
GGGACGTGGTGCACAGCTATACTGGCTTCCGGACGATTTCTACGGGGGTGGTCAAGGGGGTGCAGAGGCCGTTGC
TTAACGGCGAGTTTGTGTTTTTGTTTGGCACGCTTGATCAGGGGTTTTGGCCGGATGGGTTGTATACGCCTCCTA
CTCGGGAGGCTATGGTTTATGACCTGAAGATGCTGAAGGATCTGGGCTTTAACATGGTCAGGAAGCACGTGAGTT
TTCTCTCGGATATATCCCCTGGTTTCTTGGTGACTTATTCGCTGCAGATCAAAGTTGAACCGGATCTGTTCTACC
GAGCCTGCGATGAGATGGGCTTAATGGTCATCCAAGACATGCCCAGCCTCCCCGACGACCAAAGCCGCCCCCCCA
ACGACGCCCAACAAGCCCAGTTCCAGCGCCAGCTCGAGATTCTAATCAACGAGCATAAGAGCTACCCCTCCATCG
TCACCTGGGTGAGAATACCCCTCCATATGGCAGAGACGGGGATGCTGACTTCTGGGGGCGTAGCTGATCTACAAC
GAGGGTTGGGGACAGCGTCGTCAGGCTCCGTTCCCAGAAGGCAAGCTCACTGACGTTGTTCGCGGGATTGATTCG
ACGAGGTTGATTGACTCTGCTTCTGGATGGGTGGATCATGGCTTTGGTGATTTCTCGGTAGGACTCCCTGCTTTG
AAGTCGTCATGGGGGACTGACAAGGTGAAGGATAACCATCACTACGCTAATCCTCAGTGCGGCTCGCCCTTTTAC
TCCCTCGCTTCTCCGCCCTACGACGCGAAACGGATTGGCTTCCAGGGTGAATTCGGAGGCATAGGCCACACCCCA
ACAATAGAGCAGTAAGTCCCCCCCCTCTCCATCCCCTCAGAACAGCATCTAAGCAACCCCCCCAGTCTCTGGAAC
GTGCGCCAAGCCATCGACACGGTCAACGAAACGTACGAGATCAACGCCGACTTGGAAGCCTACAACTACCGCGCG
GGCGTGCTGTTCCGCGAGTTGCGCGAGCAGGTCGAGCGCTATGCTTGCAGCGGCGGCGTGTGGACGCAGACTACG
GATGTCGAGGGCGAGGTCAATGGCTTGTATACTTATGATCGGAGGGTTTTGAGGCCGGATGTTGGGCAGTGGAGG
GGGGATATTCGGCGGTTGTATGAGGCTGCTGCTAGGAGGGCGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail