Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5485
Gene name
LocationContig_544:11641..12507
Strand+
Gene length (bp)866
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00909 Ammonium_transp Ammonium Transporter Family 1.8E-44 34 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V1|AMT1_SCHPO Ammonium transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt1 PE=3 SV=1 14 224 6.0E-90
sp|Q9US00|AMT2_SCHPO Ammonium transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt2 PE=3 SV=1 21 224 2.0E-67
sp|P41948|MEP2_YEAST Ammonium transporter MEP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP2 PE=1 SV=1 21 227 4.0E-63
sp|P53390|MEP3_YEAST Ammonium transporter MEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP3 PE=1 SV=1 27 226 5.0E-51
sp|Q9P7F3|AMT3_SCHPO Ammonium transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt3 PE=3 SV=1 14 224 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0V1|AMT1_SCHPO Ammonium transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt1 PE=3 SV=1 14 224 6.0E-90
sp|Q9US00|AMT2_SCHPO Ammonium transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt2 PE=3 SV=1 21 224 2.0E-67
sp|P41948|MEP2_YEAST Ammonium transporter MEP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP2 PE=1 SV=1 21 227 4.0E-63
sp|P53390|MEP3_YEAST Ammonium transporter MEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP3 PE=1 SV=1 27 226 5.0E-51
sp|Q9P7F3|AMT3_SCHPO Ammonium transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amt3 PE=3 SV=1 14 224 3.0E-47
sp|P40260|MEP1_YEAST Ammonium transporter MEP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEP1 PE=1 SV=1 27 226 2.0E-46
sp|P9WQ65|AMT_MYCTU Probable ammonia channel OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=amt PE=3 SV=1 28 224 3.0E-33
sp|P9WQ64|AMT_MYCTO Probable ammonia channel OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=amt PE=3 SV=1 28 224 3.0E-33
sp|P63520|AMT_MYCBO Probable ammonia channel OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=amt PE=3 SV=1 28 224 3.0E-33
sp|Q07429|NRGA_BACSU Ammonium transporter NrgA OS=Bacillus subtilis (strain 168) GN=nrgA PE=2 SV=1 30 224 1.0E-31
sp|O26759|Y663_METTH Putative ammonium transporter MTH_663 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_663 PE=3 SV=1 21 209 1.0E-30
sp|O26757|Y661_METTH Putative ammonium transporter MTH_661 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_661 PE=3 SV=1 28 209 1.0E-29
sp|O66515|AMT_AQUAE Ammonia channel OS=Aquifex aeolicus (strain VF5) GN=amt PE=1 SV=1 28 213 3.0E-29
sp|Q9BLG4|AMT1_DICDI Ammonium transporter 1 OS=Dictyostelium discoideum GN=amtA PE=1 SV=1 28 217 8.0E-28
sp|P69681|AMTB_ECOLI Ammonia channel OS=Escherichia coli (strain K12) GN=amtB PE=1 SV=1 28 224 9.0E-28
sp|P69680|AMTB_ECO57 Ammonia channel OS=Escherichia coli O157:H7 GN=amtB PE=1 SV=1 28 224 9.0E-28
sp|P54147|Y108_SYNY3 Putative ammonium transporter sll0108 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0108 PE=3 SV=1 17 216 3.0E-19
sp|Q9LK16|AMT15_ARATH Putative ammonium transporter 1 member 5 OS=Arabidopsis thaliana GN=AMT1-5 PE=3 SV=1 24 226 2.0E-18
sp|P54146|AMT_CORGL Ammonia channel OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=amt PE=2 SV=1 28 224 4.0E-17
sp|P54144|AMT11_ARATH Ammonium transporter 1 member 1 OS=Arabidopsis thaliana GN=AMT1-1 PE=1 SV=1 24 226 1.0E-16
sp|Q9SQH9|AMT13_ARATH Ammonium transporter 1 member 3 OS=Arabidopsis thaliana GN=AMT1-3 PE=2 SV=2 33 226 1.0E-16
sp|Q9ZPJ8|AMT12_ARATH Ammonium transporter 1 member 2 OS=Arabidopsis thaliana GN=AMT1-2 PE=1 SV=1 33 226 2.0E-16
sp|Q9FVN0|AMT13_SOLLC Ammonium transporter 1 member 3 OS=Solanum lycopersicum GN=AMT1-3 PE=2 SV=1 28 227 9.0E-16
sp|O04161|AMT12_SOLLC Ammonium transporter 1 member 2 OS=Solanum lycopersicum GN=AMT1-2 PE=2 SV=1 21 226 3.0E-15
sp|Q9SVT8|AMT14_ARATH Ammonium transporter 1 member 4 OS=Arabidopsis thaliana GN=AMT1-4 PE=1 SV=1 33 226 3.0E-15
sp|Q6K9G1|AMT12_ORYSJ Ammonium transporter 1 member 2 OS=Oryza sativa subsp. japonica GN=AMT1-2 PE=2 SV=1 24 226 6.0E-14
sp|Q6K9G3|AMT13_ORYSJ Ammonium transporter 1 member 3 OS=Oryza sativa subsp. japonica GN=AMT1-3 PE=2 SV=1 16 226 7.0E-14
sp|Q7XQ12|AMT11_ORYSJ Ammonium transporter 1 member 1 OS=Oryza sativa subsp. japonica GN=AMT1-1 PE=2 SV=1 24 226 7.0E-14
sp|P54145|AMT1_CAEEL Putative ammonium transporter 1 OS=Caenorhabditis elegans GN=amt-1 PE=3 SV=1 26 211 8.0E-13
sp|P58905|AMT11_SOLLC Ammonium transporter 1 member 1 OS=Solanum lycopersicum GN=AMT1-1 PE=2 SV=1 24 226 2.0E-12
sp|Q8MXY0|AMT3_DICDI Ammonium transporter 3 OS=Dictyostelium discoideum GN=amtC PE=2 SV=1 41 219 2.0E-12
sp|Q9BLG3|AMT2_DICDI Ammonium transporter 2 OS=Dictyostelium discoideum GN=amtB PE=1 SV=1 41 219 1.0E-10
sp|Q69T29|AMT33_ORYSJ Ammonium transporter 3 member 3 OS=Oryza sativa subsp. japonica GN=AMT3-3 PE=2 SV=1 35 210 2.0E-09
sp|Q9M6N7|AMT2_ARATH Ammonium transporter 2 OS=Arabidopsis thaliana GN=AMT2 PE=1 SV=2 35 209 8.0E-09
sp|P72935|Y1017_SYNY3 Putative ammonium transporter sll1017 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1017 PE=3 SV=1 34 211 1.0E-08
sp|Q84KJ6|AMT31_ORYSJ Ammonium transporter 3 member 1 OS=Oryza sativa subsp. japonica GN=AMT3-1 PE=2 SV=1 28 210 8.0E-08
sp|Q84KJ7|AMT21_ORYSJ Ammonium transporter 2 member 1 OS=Oryza sativa subsp. japonica GN=AMT2-1 PE=2 SV=1 35 209 1.0E-07
sp|Q851M9|AMT32_ORYSJ Ammonium transporter 3 member 2 OS=Oryza sativa subsp. japonica GN=AMT3-2 PE=2 SV=1 35 209 4.0E-07
sp|Q20605|AMT2_CAEEL Putative ammonium transporter 2 OS=Caenorhabditis elegans GN=amt-2 PE=3 SV=3 35 216 3.0E-06
sp|Q8S230|AMT22_ORYSJ Ammonium transporter 2 member 2 OS=Oryza sativa subsp. japonica GN=AMT2-2 PE=2 SV=2 46 209 4.0E-06
sp|Q8S233|AMT23_ORYSJ Ammonium transporter 2 member 3 OS=Oryza sativa subsp. japonica GN=AMT2-3 PE=2 SV=1 35 209 6.0E-06
sp|Q21565|AMT3_CAEEL Putative ammonium transporter 3 OS=Caenorhabditis elegans GN=amt-3 PE=3 SV=2 38 215 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0072488 ammonium transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008519 ammonium transmembrane transporter activity Yes
GO:0051179 localization No
GO:0005216 ion channel activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0015267 channel activity No
GO:0071705 nitrogen compound transport No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0055085 transmembrane transport No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005261 cation channel activity No
GO:0022803 passive transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 61 83 22
3 121 143 22
4 148 170 22
5 185 207 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5485
MATAYNGTSGTADDGSSTGATNLNVFYDTGHLTFLTVSSVLVLLMIPGVGFFYSGLARRKSALQLVLLSMLSVAV
IGFQWFFWGYSLAFSRTGNAFLGDLSQFGLMKTIAQPNGSSFLPDILFCLYQGMFASITPALAIGAVADRGRILP
ALVFMFVWSTAVYDPIAYWTWNPNGWLYKLPSYDFAGGGPVHISSGTCALAYSLMLGRRTGYSSNGGLPYRPHSP
SA*
Coding >Ophun1|5485
ATGGCGACGGCGTACAATGGCACCAGCGGCACCGCTGACGACGGCTCTTCAACGGGGGCGACCAACCTCAACGTC
TTCTACGACACGGGCCATTTGACCTTTCTGACGGTGTCGTCGGTGCTGGTCCTGCTCATGATTCCCGGCGTCGGC
TTCTTCTACAGCGGTCTTGCCCGGCGCAAGTCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTC
ATCGGCTTCCAATGGTTCTTTTGGGGATACTCGCTCGCCTTTTCCCGCACCGGCAACGCCTTTCTCGGTGATCTA
TCGCAGTTTGGCCTGATGAAGACGATTGCTCAGCCCAATGGCTCCAGCTTTCTGCCCGACATTCTCTTTTGCCTC
TACCAGGGCATGTTTGCCTCCATCACTCCGGCACTGGCCATCGGAGCCGTAGCCGATCGCGGCCGGATCCTACCG
GCCCTCGTCTTCATGTTCGTCTGGTCAACAGCTGTATACGACCCCATCGCCTACTGGACGTGGAACCCCAACGGC
TGGCTCTACAAGCTTCCAAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCGCTC
GCCTACAGCCTCATGCTCGGCCGTCGAACCGGCTACTCCAGCAACGGCGGCCTCCCCTACCGCCCGCACAGCCCC
TCGGCATGA
Transcript >Ophun1|5485
ATGGCGACGGCGTACAATGGCACCAGCGGCACCGCTGACGACGGCTCTTCAACGGGGGCGACCAACCTCAACGTC
TTCTACGACACGGGCCATTTGACCTTTCTGACGGTGTCGTCGGTGCTGGTCCTGCTCATGATTCCCGGCGTCGGC
TTCTTCTACAGCGGTCTTGCCCGGCGCAAGTCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTC
ATCGGCTTCCAATGGTTCTTTTGGGGATACTCGCTCGCCTTTTCCCGCACCGGCAACGCCTTTCTCGGTGATCTA
TCGCAGTTTGGCCTGATGAAGACGATTGCTCAGCCCAATGGCTCCAGCTTTCTGCCCGACATTCTCTTTTGCCTC
TACCAGGGCATGTTTGCCTCCATCACTCCGGCACTGGCCATCGGAGCCGTAGCCGATCGCGGCCGGATCCTACCG
GCCCTCGTCTTCATGTTCGTCTGGTCAACAGCTGTATACGACCCCATCGCCTACTGGACGTGGAACCCCAACGGC
TGGCTCTACAAGCTTCCAAGCTACGACTTCGCCGGCGGCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCGCTC
GCCTACAGCCTCATGCTCGGCCGTCGAACCGGCTACTCCAGCAACGGCGGCCTCCCCTACCGCCCGCACAGCCCC
TCGGCATGA
Gene >Ophun1|5485
ATGGCGACGGCGTACAATGGCACCAGCGGCACCGCTGACGACGGCTCTTCAACGGGGGCGACCAACCTCAACGTC
TTCTACGACGTACGTCTCTGCTCTGGGCCTCCTTGGAGGCTACCACGGCTTCTAACCGGTCGCAGACGGGCCATT
TGACCTTTCTGACGGTGTCGTCGGTGCTGGTCCTGCTCATGATTCCCGGCGTCGGCTTCTTCTACAGCGGTCTTG
CCCGGCGCAAGTCGGCGCTGCAGCTCGTCCTGCTGTCGATGCTGTCCGTCGCCGTCATCGGCTTCCAATGGTTCT
TTTGGGGATACTCGCTCGCCTTTTCCCGCACCGGCAACGCCTTTCTCGGTGATCTATCGCAGTTTGGCCTGATGA
AGACGATTGCTCAGCCCAATGGCTCCAGCTTTCTGCCCGACATTCTCTTTTGCCTCTACCAGGGCATGTTTGCCT
CCATCACGTTCGTCCACGACAAGCCCCCTTGTTCCCTACTGGTGTGATGTTGACGCAACCTCGCAGTCCGGCACT
GGCCATCGGAGCCGTAGCCGATCGCGGCCGGATCCTACCGGCCCTCGTCTTCATGTTCGTCTGGTCAACAGCTGT
ATACGACCCCATCGCCTACTGGACGTGGAACCCCAACGGCTGGCTCTACAAGCTTCCAAGCTACGACTTCGCCGG
CGGCGGCCCCGTCCACATCTCGTCCGGCACCTGCGCGCTCGCCTACAGCCTCATGCTCGGCCGTCGAACCGGCTA
CTCCAGCAACGGCGGCCTCCCCTACCGCCCGCACAGCGTGACAAACGTCGTCCTCGGCACCGTCTTCCTCTGGGT
CGGCTGGTTCGGCTTCAACGGCGGGTCAGCCCTCGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail