Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5484
Gene name
LocationContig_544:9511..10162
Strand+
Gene length (bp)651
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase 4.8E-25 7 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2UXS9|PTH_CLOBA Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pth PE=3 SV=1 6 189 2.0E-15
sp|O74806|PTH_SCHPO Probable peptidyl-tRNA hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pth1 PE=3 SV=2 7 190 1.0E-14
sp|B2TI10|PTH_CLOBB Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pth PE=3 SV=1 6 189 1.0E-14
sp|Q60A14|PTH_METCA Peptidyl-tRNA hydrolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pth PE=3 SV=1 7 183 2.0E-14
sp|A5EWU9|PTH_DICNV Peptidyl-tRNA hydrolase OS=Dichelobacter nodosus (strain VCS1703A) GN=pth PE=3 SV=1 7 174 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2UXS9|PTH_CLOBA Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pth PE=3 SV=1 6 189 2.0E-15
sp|O74806|PTH_SCHPO Probable peptidyl-tRNA hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pth1 PE=3 SV=2 7 190 1.0E-14
sp|B2TI10|PTH_CLOBB Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pth PE=3 SV=1 6 189 1.0E-14
sp|Q60A14|PTH_METCA Peptidyl-tRNA hydrolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pth PE=3 SV=1 7 183 2.0E-14
sp|A5EWU9|PTH_DICNV Peptidyl-tRNA hydrolase OS=Dichelobacter nodosus (strain VCS1703A) GN=pth PE=3 SV=1 7 174 5.0E-14
sp|A9BP19|PTH_DELAS Peptidyl-tRNA hydrolase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=pth PE=3 SV=1 7 180 2.0E-13
sp|B9M5U5|PTH_GEODF Peptidyl-tRNA hydrolase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pth PE=3 SV=1 7 177 5.0E-13
sp|A1TT75|PTH_ACIAC Peptidyl-tRNA hydrolase OS=Acidovorax citrulli (strain AAC00-1) GN=pth PE=3 SV=1 7 189 5.0E-13
sp|Q9RRW3|PTH_DEIRA Peptidyl-tRNA hydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pth PE=3 SV=1 7 174 8.0E-13
sp|Q2JNF7|PTH_SYNJB Peptidyl-tRNA hydrolase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pth PE=3 SV=1 7 175 2.0E-12
sp|Q97E97|PTH_CLOAB Peptidyl-tRNA hydrolase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pth PE=3 SV=1 6 175 2.0E-12
sp|A1AXW5|PTH_RUTMC Peptidyl-tRNA hydrolase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=pth PE=3 SV=1 7 191 3.0E-12
sp|Q8DWN5|PTH_STRMU Peptidyl-tRNA hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pth PE=3 SV=1 7 195 4.0E-12
sp|A4XIS3|PTH_CALS8 Peptidyl-tRNA hydrolase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pth PE=3 SV=1 6 190 4.0E-12
sp|Q033H5|PTH_LACLS Peptidyl-tRNA hydrolase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=pth PE=3 SV=1 7 172 4.0E-12
sp|A2RH85|PTH_LACLM Peptidyl-tRNA hydrolase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pth PE=3 SV=1 7 172 6.0E-12
sp|Q2YBH2|PTH_NITMU Peptidyl-tRNA hydrolase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pth PE=3 SV=1 7 184 6.0E-12
sp|A7GJW3|PTH_BACCN Peptidyl-tRNA hydrolase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pth PE=3 SV=1 7 185 7.0E-12
sp|A1W4G0|PTH_ACISJ Peptidyl-tRNA hydrolase OS=Acidovorax sp. (strain JS42) GN=pth PE=3 SV=1 7 178 9.0E-12
sp|B9ME46|PTH_ACIET Peptidyl-tRNA hydrolase OS=Acidovorax ebreus (strain TPSY) GN=pth PE=3 SV=1 7 178 9.0E-12
sp|Q2JV16|PTH_SYNJA Peptidyl-tRNA hydrolase OS=Synechococcus sp. (strain JA-3-3Ab) GN=pth PE=3 SV=1 7 175 9.0E-12
sp|Q21XW1|PTH_RHOFT Peptidyl-tRNA hydrolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pth PE=3 SV=2 7 179 2.0E-11
sp|B4RT72|PTH_ALTMD Peptidyl-tRNA hydrolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pth PE=3 SV=1 7 196 2.0E-11
sp|Q6AAC7|PTH_PROAC Peptidyl-tRNA hydrolase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pth PE=3 SV=1 2 186 2.0E-11
sp|A6TJM7|PTH_ALKMQ Peptidyl-tRNA hydrolase OS=Alkaliphilus metalliredigens (strain QYMF) GN=pth PE=3 SV=1 6 159 2.0E-11
sp|A5I7R5|PTH_CLOBH Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pth PE=3 SV=1 6 191 3.0E-11
sp|A7FPJ7|PTH_CLOB1 Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=pth PE=3 SV=1 6 191 3.0E-11
sp|Q6HPW6|PTH_BACHK Peptidyl-tRNA hydrolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pth PE=3 SV=1 7 170 3.0E-11
sp|Q81VY9|PTH_BACAN Peptidyl-tRNA hydrolase OS=Bacillus anthracis GN=pth PE=3 SV=1 7 170 3.0E-11
sp|B2UPQ2|PTH_AKKM8 Peptidyl-tRNA hydrolase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=pth PE=3 SV=1 4 175 3.0E-11
sp|B1Y3Q1|PTH_LEPCP Peptidyl-tRNA hydrolase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pth PE=3 SV=1 7 178 4.0E-11
sp|Q82TQ6|PTH_NITEU Peptidyl-tRNA hydrolase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=pth PE=3 SV=1 4 184 5.0E-11
sp|Q5WAD6|PTH_BACSK Peptidyl-tRNA hydrolase OS=Bacillus clausii (strain KSM-K16) GN=pth PE=3 SV=1 7 193 5.0E-11
sp|Q31IN3|PTH_THICR Peptidyl-tRNA hydrolase OS=Thiomicrospira crunogena (strain XCL-2) GN=pth PE=3 SV=1 7 180 6.0E-11
sp|Q47SW2|PTH_THEFY Peptidyl-tRNA hydrolase OS=Thermobifida fusca (strain YX) GN=pth PE=3 SV=1 6 175 6.0E-11
sp|Q9CJI1|PTH_LACLA Peptidyl-tRNA hydrolase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pth PE=3 SV=1 7 172 7.0E-11
sp|Q63HI2|PTH_BACCZ Peptidyl-tRNA hydrolase OS=Bacillus cereus (strain ZK / E33L) GN=pth PE=3 SV=1 7 170 8.0E-11
sp|B9IZD4|PTH_BACCQ Peptidyl-tRNA hydrolase OS=Bacillus cereus (strain Q1) GN=pth PE=3 SV=1 7 170 8.0E-11
sp|Q73FF7|PTH_BACC1 Peptidyl-tRNA hydrolase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pth PE=3 SV=2 7 170 8.0E-11
sp|P38876|PTH_YEAST Peptidyl-tRNA hydrolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTH1 PE=1 SV=1 6 174 8.0E-11
sp|Q81J96|PTH_BACCR Peptidyl-tRNA hydrolase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pth PE=3 SV=2 7 170 8.0E-11
sp|Q3K419|PTH_STRA1 Peptidyl-tRNA hydrolase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pth PE=3 SV=1 7 171 8.0E-11
sp|B2V6V4|PTH_SULSY Peptidyl-tRNA hydrolase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=pth PE=3 SV=1 8 179 8.0E-11
sp|C3KW96|PTH_CLOB6 Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=pth PE=3 SV=1 6 191 8.0E-11
sp|B9MPK0|PTH_CALBD Peptidyl-tRNA hydrolase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pth PE=3 SV=1 6 189 8.0E-11
sp|A7GJD4|PTH_CLOBL Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=pth PE=3 SV=1 6 191 1.0E-10
sp|Q74LA8|PTH_LACJO Peptidyl-tRNA hydrolase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pth PE=3 SV=1 7 178 1.0E-10
sp|C1FNE6|PTH_CLOBJ Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=pth PE=3 SV=1 6 191 1.0E-10
sp|P37470|PTH_BACSU Peptidyl-tRNA hydrolase OS=Bacillus subtilis (strain 168) GN=spoVC PE=3 SV=1 6 177 1.0E-10
sp|Q8E2I1|PTH_STRA5 Peptidyl-tRNA hydrolase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pth PE=3 SV=1 7 171 1.0E-10
sp|Q8E7Y8|PTH_STRA3 Peptidyl-tRNA hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pth PE=3 SV=1 7 171 1.0E-10
sp|Q9KGJ3|PTH_BACHD Peptidyl-tRNA hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pth PE=3 SV=1 7 188 1.0E-10
sp|B1KTE2|PTH_CLOBM Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=pth PE=3 SV=1 6 191 1.0E-10
sp|C1CNN8|PTH_STRZT Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|C1CN70|PTH_STRZP Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain P1031) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|Q97TD1|PTH_STRPN Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|B1I6X7|PTH_STRPI Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|C1C986|PTH_STRP7 Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain 70585) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|B5E572|PTH_STRP4 Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|C1CH85|PTH_STRZJ Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain JJA) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|B8ZJI3|PTH_STRPJ Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|Q5L3U7|PTH_GEOKA Peptidyl-tRNA hydrolase OS=Geobacillus kaustophilus (strain HTA426) GN=pth PE=3 SV=1 7 177 2.0E-10
sp|A8LRY5|PTH_DINSH Peptidyl-tRNA hydrolase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pth PE=3 SV=1 7 169 2.0E-10
sp|Q8DRQ2|PTH_STRR6 Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|Q04N59|PTH_STRP2 Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=pth PE=3 SV=1 7 167 2.0E-10
sp|C5CYZ7|PTH_VARPS Peptidyl-tRNA hydrolase OS=Variovorax paradoxus (strain S110) GN=pth PE=3 SV=1 7 178 2.0E-10
sp|A4VS92|PTH_STRSY Peptidyl-tRNA hydrolase OS=Streptococcus suis (strain 05ZYH33) GN=pth PE=3 SV=1 7 192 2.0E-10
sp|A4VYI0|PTH_STRS2 Peptidyl-tRNA hydrolase OS=Streptococcus suis (strain 98HAH33) GN=pth PE=3 SV=1 7 192 2.0E-10
sp|A6LPJ5|PTH_CLOB8 Peptidyl-tRNA hydrolase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pth PE=3 SV=1 6 152 3.0E-10
sp|B4U930|PTH_HYDS0 Peptidyl-tRNA hydrolase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=pth PE=3 SV=1 8 164 3.0E-10
sp|B1IGZ7|PTH_CLOBK Peptidyl-tRNA hydrolase OS=Clostridium botulinum (strain Okra / Type B1) GN=pth PE=3 SV=1 6 191 3.0E-10
sp|Q7VG29|PTH_HELHP Peptidyl-tRNA hydrolase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=pth PE=3 SV=1 4 192 5.0E-10
sp|A5UGR0|PTH_HAEIG Peptidyl-tRNA hydrolase OS=Haemophilus influenzae (strain PittGG) GN=pth PE=3 SV=1 7 175 5.0E-10
sp|B2IQZ3|PTH_STRPS Peptidyl-tRNA hydrolase OS=Streptococcus pneumoniae (strain CGSP14) GN=pth PE=3 SV=1 7 167 5.0E-10
sp|Q7V342|PTH_PROMP Peptidyl-tRNA hydrolase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=pth PE=3 SV=1 1 197 6.0E-10
sp|A3CJX1|PTH_STRSV Peptidyl-tRNA hydrolase OS=Streptococcus sanguinis (strain SK36) GN=pth PE=3 SV=1 7 167 6.0E-10
sp|Q057V0|PTH_BUCCC Peptidyl-tRNA hydrolase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=pth PE=3 SV=1 7 157 7.0E-10
sp|Q0AGY5|PTH_NITEC Peptidyl-tRNA hydrolase OS=Nitrosomonas eutropha (strain C91) GN=pth PE=3 SV=1 4 184 7.0E-10
sp|Q181A2|PTH_PEPD6 Peptidyl-tRNA hydrolase OS=Peptoclostridium difficile (strain 630) GN=pth PE=3 SV=1 6 188 8.0E-10
sp|A9I6W1|PTH_BORPD Peptidyl-tRNA hydrolase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pth PE=3 SV=1 7 179 8.0E-10
sp|A5G7R5|PTH_GEOUR Peptidyl-tRNA hydrolase OS=Geobacter uraniireducens (strain Rf4) GN=pth PE=3 SV=1 7 167 1.0E-09
sp|Q03DZ8|PTH_PEDPA Peptidyl-tRNA hydrolase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=pth PE=3 SV=1 7 196 1.0E-09
sp|B5EHX1|PTH_GEOBB Peptidyl-tRNA hydrolase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=pth PE=3 SV=1 7 191 1.0E-09
sp|Q8XHJ8|PTH_CLOPE Peptidyl-tRNA hydrolase OS=Clostridium perfringens (strain 13 / Type A) GN=pth PE=3 SV=1 6 175 1.0E-09
sp|Q0TMG7|PTH_CLOP1 Peptidyl-tRNA hydrolase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pth PE=3 SV=1 6 175 1.0E-09
sp|Q8YAD1|PTH_LISMO Peptidyl-tRNA hydrolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pth PE=3 SV=1 7 199 2.0E-09
sp|Q03SZ9|PTH_LACBA Peptidyl-tRNA hydrolase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pth PE=3 SV=1 7 192 2.0E-09
sp|B8DGL2|PTH_LISMH Peptidyl-tRNA hydrolase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pth PE=3 SV=1 7 199 2.0E-09
sp|B1I197|PTH_DESAP Peptidyl-tRNA hydrolase OS=Desulforudis audaxviator (strain MP104C) GN=pth PE=3 SV=1 7 151 2.0E-09
sp|Q0SQ66|PTH_CLOPS Peptidyl-tRNA hydrolase OS=Clostridium perfringens (strain SM101 / Type A) GN=pth PE=3 SV=1 6 175 2.0E-09
sp|Q3SLR3|PTH_THIDA Peptidyl-tRNA hydrolase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pth PE=3 SV=1 4 178 2.0E-09
sp|B9DSP2|PTH_STRU0 Peptidyl-tRNA hydrolase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=pth PE=3 SV=1 7 195 2.0E-09
sp|B4RK78|PTH_NEIG2 Peptidyl-tRNA hydrolase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pth PE=3 SV=1 1 180 2.0E-09
sp|Q5F9L4|PTH_NEIG1 Peptidyl-tRNA hydrolase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pth PE=3 SV=1 1 180 2.0E-09
sp|Q0B0S6|PTH_SYNWW Peptidyl-tRNA hydrolase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=pth PE=3 SV=1 7 183 2.0E-09
sp|Q59989|PTH_SYNY3 Peptidyl-tRNA hydrolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pth PE=3 SV=1 7 169 2.0E-09
sp|Q2J5Z1|PTH_FRASC Peptidyl-tRNA hydrolase OS=Frankia sp. (strain CcI3) GN=pth PE=3 SV=1 6 202 2.0E-09
sp|Q1B425|PTH_MYCSS Peptidyl-tRNA hydrolase OS=Mycobacterium sp. (strain MCS) GN=pth PE=3 SV=1 6 171 2.0E-09
sp|A1UL23|PTH_MYCSK Peptidyl-tRNA hydrolase OS=Mycobacterium sp. (strain KMS) GN=pth PE=3 SV=1 6 171 2.0E-09
sp|A3Q5H1|PTH_MYCSJ Peptidyl-tRNA hydrolase OS=Mycobacterium sp. (strain JLS) GN=pth PE=3 SV=1 6 171 2.0E-09
sp|C6E501|PTH_GEOSM Peptidyl-tRNA hydrolase OS=Geobacter sp. (strain M21) GN=pth PE=3 SV=1 7 191 3.0E-09
sp|A4IJC9|PTH_GEOTN Peptidyl-tRNA hydrolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pth PE=3 SV=1 7 171 3.0E-09
sp|Q74FE6|PTH_GEOSL Peptidyl-tRNA hydrolase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pth PE=3 SV=1 7 174 3.0E-09
sp|Q7W179|PTH_BORPA Peptidyl-tRNA hydrolase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pth PE=3 SV=1 1 179 3.0E-09
sp|Q7WNY2|PTH_BORBR Peptidyl-tRNA hydrolase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pth PE=3 SV=1 1 179 3.0E-09
sp|A0AF11|PTH_LISW6 Peptidyl-tRNA hydrolase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pth PE=3 SV=1 7 199 3.0E-09
sp|P44682|PTH_HAEIN Peptidyl-tRNA hydrolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pth PE=3 SV=1 7 175 3.0E-09
sp|Q4QNE8|PTH_HAEI8 Peptidyl-tRNA hydrolase OS=Haemophilus influenzae (strain 86-028NP) GN=pth PE=3 SV=1 7 175 3.0E-09
sp|B3PNH1|PTH_MYCA5 Peptidyl-tRNA hydrolase OS=Mycoplasma arthritidis (strain 158L3-1) GN=pth PE=3 SV=1 7 170 4.0E-09
sp|Q899I4|PTH_CLOTE Peptidyl-tRNA hydrolase OS=Clostridium tetani (strain Massachusetts / E88) GN=pth PE=3 SV=1 6 175 4.0E-09
sp|A4T6N5|PTH_MYCGI Peptidyl-tRNA hydrolase OS=Mycobacterium gilvum (strain PYR-GCK) GN=pth PE=3 SV=1 7 189 4.0E-09
sp|A1TEG1|PTH_MYCVP Peptidyl-tRNA hydrolase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pth PE=3 SV=1 7 174 4.0E-09
sp|A1B1H5|PTH_PARDP Peptidyl-tRNA hydrolase OS=Paracoccus denitrificans (strain Pd 1222) GN=pth PE=3 SV=1 7 175 5.0E-09
sp|Q046E4|PTH_LACGA Peptidyl-tRNA hydrolase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=pth PE=3 SV=1 7 178 5.0E-09
sp|A0PXL3|PTH_CLONN Peptidyl-tRNA hydrolase OS=Clostridium novyi (strain NT) GN=pth PE=3 SV=1 6 186 5.0E-09
sp|Q724K0|PTH_LISMF Peptidyl-tRNA hydrolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pth PE=3 SV=1 7 199 5.0E-09
sp|C1KYE6|PTH_LISMC Peptidyl-tRNA hydrolase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pth PE=3 SV=1 7 199 5.0E-09
sp|A1KT53|PTH_NEIMF Peptidyl-tRNA hydrolase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pth PE=3 SV=1 1 180 6.0E-09
sp|Q9K029|PTH_NEIMB Peptidyl-tRNA hydrolase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pth PE=3 SV=1 1 180 6.0E-09
sp|P57287|PTH_BUCAI Peptidyl-tRNA hydrolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pth PE=3 SV=1 7 171 7.0E-09
sp|B8D8Y9|PTH_BUCA5 Peptidyl-tRNA hydrolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pth PE=3 SV=1 7 171 7.0E-09
sp|C4ZBV8|PTH_EUBR3 Peptidyl-tRNA hydrolase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=pth PE=3 SV=1 6 179 7.0E-09
sp|Q1WSG3|PTH_LACS1 Peptidyl-tRNA hydrolase OS=Lactobacillus salivarius (strain UCC118) GN=pth PE=3 SV=1 7 196 9.0E-09
sp|Q839C0|PTH_ENTFA Peptidyl-tRNA hydrolase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pth PE=3 SV=1 7 196 9.0E-09
sp|Q8R757|PTH_CALS4 Peptidyl-tRNA hydrolase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pth PE=3 SV=1 6 191 1.0E-08
sp|Q9F8Q3|PTH_CARHZ Peptidyl-tRNA hydrolase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pth PE=3 SV=2 6 199 1.0E-08
sp|Q251S4|PTH_DESHY Peptidyl-tRNA hydrolase OS=Desulfitobacterium hafniense (strain Y51) GN=pth PE=3 SV=2 7 159 1.0E-08
sp|B8FZA5|PTH_DESHD Peptidyl-tRNA hydrolase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=pth PE=3 SV=1 7 159 1.0E-08
sp|A6W6V3|PTH_KINRD Peptidyl-tRNA hydrolase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=pth PE=3 SV=1 7 174 1.0E-08
sp|Q39RR0|PTH_GEOMG Peptidyl-tRNA hydrolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pth PE=3 SV=1 7 174 1.0E-08
sp|Q0RCD6|PTH_FRAAA Peptidyl-tRNA hydrolase OS=Frankia alni (strain ACN14a) GN=pth PE=3 SV=1 6 174 2.0E-08
sp|Q92F62|PTH_LISIN Peptidyl-tRNA hydrolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pth PE=3 SV=1 7 199 2.0E-08
sp|Q04C43|PTH_LACDB Peptidyl-tRNA hydrolase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=pth PE=3 SV=1 7 179 2.0E-08
sp|Q1GBP4|PTH_LACDA Peptidyl-tRNA hydrolase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pth PE=3 SV=1 7 179 2.0E-08
sp|C0MC67|PTH_STRS7 Peptidyl-tRNA hydrolase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pth PE=3 SV=1 7 196 2.0E-08
sp|P0DD51|PTH_STRPQ Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pth PE=3 SV=1 7 168 2.0E-08
sp|P0DD50|PTH_STRP3 Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pth PE=3 SV=1 7 168 2.0E-08
sp|B0K466|PTH_THEPX Peptidyl-tRNA hydrolase OS=Thermoanaerobacter sp. (strain X514) GN=pth PE=3 SV=1 6 191 2.0E-08
sp|B0S0D9|PTH_FINM2 Peptidyl-tRNA hydrolase OS=Finegoldia magna (strain ATCC 29328) GN=pth PE=3 SV=1 6 175 3.0E-08
sp|Q73Q01|PTH_TREDE Peptidyl-tRNA hydrolase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=pth PE=3 SV=1 7 169 3.0E-08
sp|Q2YVY3|PTH_STAAB Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pth PE=3 SV=1 8 175 3.0E-08
sp|P65869|PTH_STAAW Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain MW2) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|Q6YP15|PTH_STAAU Peptidyl-tRNA hydrolase OS=Staphylococcus aureus GN=pth PE=1 SV=1 8 182 3.0E-08
sp|A8Z0Z1|PTH_STAAT Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|Q6GBY6|PTH_STAAS Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain MSSA476) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|Q6GJG9|PTH_STAAR Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain MRSA252) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|P65868|PTH_STAAN Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain N315) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|P65867|PTH_STAAM Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|A6QEF5|PTH_STAAE Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain Newman) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|Q5HIH3|PTH_STAAC Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain COL) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|A5IQ55|PTH_STAA9 Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain JH9) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|Q2G0R9|PTH_STAA8 Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain NCTC 8325) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|Q2FJD9|PTH_STAA3 Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain USA300) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|A6TYX7|PTH_STAA2 Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain JH1) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|A7WYQ5|PTH_STAA1 Peptidyl-tRNA hydrolase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pth PE=3 SV=1 8 182 3.0E-08
sp|A8B006|PTH_STRGC Peptidyl-tRNA hydrolase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pth PE=3 SV=1 7 167 3.0E-08
sp|Q3JDQ7|PTH_NITOC Peptidyl-tRNA hydrolase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pth PE=3 SV=1 1 179 3.0E-08
sp|C5BT03|PTH_TERTT Peptidyl-tRNA hydrolase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pth PE=3 SV=1 1 177 4.0E-08
sp|Q0I248|PTH_HAES1 Peptidyl-tRNA hydrolase OS=Haemophilus somnus (strain 129Pt) GN=pth PE=3 SV=1 7 177 4.0E-08
sp|Q65PG8|PTH_BACLD Peptidyl-tRNA hydrolase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pth PE=3 SV=1 11 190 4.0E-08
sp|A8MK43|PTH_ALKOO Peptidyl-tRNA hydrolase OS=Alkaliphilus oremlandii (strain OhILAs) GN=pth PE=3 SV=1 7 165 5.0E-08
sp|B5XIP6|PTH_STRPZ Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=pth PE=1 SV=1 7 168 5.0E-08
sp|Q48VW8|PTH_STRPM Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pth PE=3 SV=2 7 168 5.0E-08
sp|Q1JJA3|PTH_STRPD Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pth PE=3 SV=2 7 168 5.0E-08
sp|Q1JP56|PTH_STRPC Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pth PE=3 SV=2 7 168 5.0E-08
sp|Q1JEA1|PTH_STRPB Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pth PE=3 SV=2 7 168 5.0E-08
sp|Q9A206|PTH_STRP1 Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M1 GN=pth PE=3 SV=1 7 168 5.0E-08
sp|Q7NQT1|PTH_CHRVO Peptidyl-tRNA hydrolase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pth PE=3 SV=1 7 177 5.0E-08
sp|A6VC68|PTH_PSEA7 Peptidyl-tRNA hydrolase OS=Pseudomonas aeruginosa (strain PA7) GN=pth PE=3 SV=1 7 175 5.0E-08
sp|B3WAP7|PTH_LACCB Peptidyl-tRNA hydrolase OS=Lactobacillus casei (strain BL23) GN=pth PE=3 SV=1 7 178 6.0E-08
sp|B1KDV1|PTH_SHEWM Peptidyl-tRNA hydrolase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pth PE=3 SV=1 7 192 6.0E-08
sp|Q3Z8W2|PTH_DEHM1 Peptidyl-tRNA hydrolase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pth PE=3 SV=1 7 186 6.0E-08
sp|C1A349|PTH_RHOE4 Peptidyl-tRNA hydrolase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=pth PE=3 SV=1 7 186 7.0E-08
sp|Q83HD8|PTH_TROW8 Peptidyl-tRNA hydrolase OS=Tropheryma whipplei (strain TW08/27) GN=pth PE=3 SV=1 6 167 7.0E-08
sp|Q83FR1|PTH_TROWT Peptidyl-tRNA hydrolase OS=Tropheryma whipplei (strain Twist) GN=pth PE=3 SV=1 6 167 7.0E-08
sp|A9M3M7|PTH_NEIM0 Peptidyl-tRNA hydrolase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pth PE=3 SV=1 1 180 8.0E-08
sp|C4L932|PTH_TOLAT Peptidyl-tRNA hydrolase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pth PE=3 SV=1 1 192 9.0E-08
sp|A2SKU1|PTH_METPP Peptidyl-tRNA hydrolase OS=Methylibium petroleiphilum (strain PM1) GN=pth PE=3 SV=1 7 165 9.0E-08
sp|C6C0N2|PTH_DESAD Peptidyl-tRNA hydrolase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=pth PE=3 SV=1 7 168 9.0E-08
sp|A1R4G4|PTH_ARTAT Peptidyl-tRNA hydrolase OS=Arthrobacter aurescens (strain TC1) GN=pth PE=3 SV=1 6 191 1.0E-07
sp|A4T070|PTH_POLSQ Peptidyl-tRNA hydrolase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pth PE=3 SV=1 7 180 1.0E-07
sp|A4J0Q6|PTH_DESRM Peptidyl-tRNA hydrolase OS=Desulfotomaculum reducens (strain MI-1) GN=pth PE=3 SV=1 7 196 1.0E-07
sp|Q034V1|PTH_LACC3 Peptidyl-tRNA hydrolase OS=Lactobacillus casei (strain ATCC 334) GN=pth PE=3 SV=1 7 178 1.0E-07
sp|A2RBX7|PTH_STRPG Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=pth PE=3 SV=1 7 168 1.0E-07
sp|Q1J956|PTH_STRPF Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pth PE=3 SV=2 7 168 1.0E-07
sp|Q8P327|PTH_STRP8 Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pth PE=3 SV=1 7 168 1.0E-07
sp|Q5XEM3|PTH_STRP6 Peptidyl-tRNA hydrolase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pth PE=3 SV=2 7 168 1.0E-07
sp|B0UVY6|PTH_HISS2 Peptidyl-tRNA hydrolase OS=Histophilus somni (strain 2336) GN=pth PE=3 SV=1 7 169 1.0E-07
sp|Q3ZX09|PTH_DEHMC Peptidyl-tRNA hydrolase OS=Dehalococcoides mccartyi (strain CBDB1) GN=pth PE=3 SV=1 7 175 1.0E-07
sp|A8FYZ9|PTH_SHESH Peptidyl-tRNA hydrolase OS=Shewanella sediminis (strain HAW-EB3) GN=pth PE=3 SV=1 7 192 1.0E-07
sp|Q8CQU9|PTH_STAES Peptidyl-tRNA hydrolase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pth PE=3 SV=1 8 182 2.0E-07
sp|Q5HRQ3|PTH_STAEQ Peptidyl-tRNA hydrolase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pth PE=3 SV=1 8 182 2.0E-07
sp|A5FRL3|PTH_DEHMB Peptidyl-tRNA hydrolase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pth PE=3 SV=1 7 175 2.0E-07
sp|Q9K3T8|PTH_STRCO Peptidyl-tRNA hydrolase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pth PE=3 SV=1 7 189 2.0E-07
sp|Q9HVC3|PTH_PSEAE Peptidyl-tRNA hydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pth PE=1 SV=1 7 175 2.0E-07
sp|Q02G02|PTH_PSEAB Peptidyl-tRNA hydrolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pth PE=3 SV=1 7 175 2.0E-07
sp|B7V0L8|PTH_PSEA8 Peptidyl-tRNA hydrolase OS=Pseudomonas aeruginosa (strain LESB58) GN=pth PE=3 SV=1 7 175 2.0E-07
sp|Q88PX8|PTH_PSEPK Peptidyl-tRNA hydrolase OS=Pseudomonas putida (strain KT2440) GN=pth PE=3 SV=1 7 178 2.0E-07
sp|A5VYF8|PTH_PSEP1 Peptidyl-tRNA hydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pth PE=3 SV=1 7 178 2.0E-07
sp|Q1IEY8|PTH_PSEE4 Peptidyl-tRNA hydrolase OS=Pseudomonas entomophila (strain L48) GN=pth PE=3 SV=1 7 178 2.0E-07
sp|A1K3G5|PTH_AZOSB Peptidyl-tRNA hydrolase OS=Azoarcus sp. (strain BH72) GN=pth PE=3 SV=1 4 164 2.0E-07
sp|B7LSI6|PTH_ESCF3 Peptidyl-tRNA hydrolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pth PE=3 SV=1 7 196 2.0E-07
sp|A1WVQ1|PTH_HALHL Peptidyl-tRNA hydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pth PE=3 SV=1 5 189 3.0E-07
sp|P57820|PTH_PASMU Peptidyl-tRNA hydrolase OS=Pasteurella multocida (strain Pm70) GN=pth PE=3 SV=1 7 169 3.0E-07
sp|B2GA68|PTH_LACF3 Peptidyl-tRNA hydrolase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=pth PE=3 SV=1 7 177 3.0E-07
sp|B2VEI9|PTH_ERWT9 Peptidyl-tRNA hydrolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pth PE=3 SV=1 7 196 3.0E-07
sp|B0TR35|PTH_SHEHH Peptidyl-tRNA hydrolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pth PE=3 SV=1 7 185 3.0E-07
sp|B0KND4|PTH_PSEPG Peptidyl-tRNA hydrolase OS=Pseudomonas putida (strain GB-1) GN=pth PE=3 SV=1 7 178 4.0E-07
sp|Q7UKV0|PTH_RHOBA Peptidyl-tRNA hydrolase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pth PE=3 SV=1 7 179 4.0E-07
sp|Q3A314|PTH_PELCD Peptidyl-tRNA hydrolase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pth PE=3 SV=1 7 194 4.0E-07
sp|Q32H03|PTH_SHIDS Peptidyl-tRNA hydrolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pth PE=3 SV=1 7 193 4.0E-07
sp|B5Y8L1|PTH_COPPD Peptidyl-tRNA hydrolase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=pth PE=3 SV=1 6 189 4.0E-07
sp|A3QH38|PTH_SHELP Peptidyl-tRNA hydrolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pth PE=3 SV=1 7 175 5.0E-07
sp|B1JEQ3|PTH_PSEPW Peptidyl-tRNA hydrolase OS=Pseudomonas putida (strain W619) GN=pth PE=3 SV=1 7 178 5.0E-07
sp|B4EVR1|PTH_PROMH Peptidyl-tRNA hydrolase OS=Proteus mirabilis (strain HI4320) GN=pth PE=3 SV=1 7 197 5.0E-07
sp|B1XS66|PTH_POLNS Peptidyl-tRNA hydrolase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=pth PE=3 SV=1 7 180 5.0E-07
sp|Q3Z0S2|PTH_SHISS Peptidyl-tRNA hydrolase OS=Shigella sonnei (strain Ss046) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|Q0T5J1|PTH_SHIF8 Peptidyl-tRNA hydrolase OS=Shigella flexneri serotype 5b (strain 8401) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|Q1RCN4|PTH_ECOUT Peptidyl-tRNA hydrolase OS=Escherichia coli (strain UTI89 / UPEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B1LH96|PTH_ECOSM Peptidyl-tRNA hydrolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B6I9R9|PTH_ECOSE Peptidyl-tRNA hydrolase OS=Escherichia coli (strain SE11) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|P0A7D1|PTH_ECOLI Peptidyl-tRNA hydrolase OS=Escherichia coli (strain K12) GN=pth PE=1 SV=1 7 193 5.0E-07
sp|B1IU89|PTH_ECOLC Peptidyl-tRNA hydrolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|P0A7D2|PTH_ECOL6 Peptidyl-tRNA hydrolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|Q0TIG6|PTH_ECOL5 Peptidyl-tRNA hydrolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|A7ZZE0|PTH_ECOHS Peptidyl-tRNA hydrolase OS=Escherichia coli O9:H4 (strain HS) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B1XAP5|PTH_ECODH Peptidyl-tRNA hydrolase OS=Escherichia coli (strain K12 / DH10B) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|C4ZTP5|PTH_ECOBW Peptidyl-tRNA hydrolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B7LXB9|PTH_ECO8A Peptidyl-tRNA hydrolase OS=Escherichia coli O8 (strain IAI1) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B7MTY8|PTH_ECO81 Peptidyl-tRNA hydrolase OS=Escherichia coli O81 (strain ED1a) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B7NUX0|PTH_ECO7I Peptidyl-tRNA hydrolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B5YXM2|PTH_ECO5E Peptidyl-tRNA hydrolase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|P0A7D3|PTH_ECO57 Peptidyl-tRNA hydrolase OS=Escherichia coli O157:H7 GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B7LGW4|PTH_ECO55 Peptidyl-tRNA hydrolase OS=Escherichia coli (strain 55989 / EAEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B7MKA6|PTH_ECO45 Peptidyl-tRNA hydrolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|B7UQ92|PTH_ECO27 Peptidyl-tRNA hydrolase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|A7ZKX7|PTH_ECO24 Peptidyl-tRNA hydrolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pth PE=3 SV=1 7 193 5.0E-07
sp|Q5P722|PTH_AROAE Peptidyl-tRNA hydrolase OS=Aromatoleum aromaticum (strain EbN1) GN=pth PE=3 SV=1 7 164 6.0E-07
sp|A1UTH5|PTH_BARBK Peptidyl-tRNA hydrolase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pth PE=3 SV=1 6 183 6.0E-07
sp|A3MYA5|PTH_ACTP2 Peptidyl-tRNA hydrolase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pth PE=3 SV=1 7 177 6.0E-07
sp|B3E6F9|PTH_GEOLS Peptidyl-tRNA hydrolase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pth PE=3 SV=1 6 150 6.0E-07
sp|C1DEV7|PTH_AZOVD Peptidyl-tRNA hydrolase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pth PE=3 SV=1 7 178 7.0E-07
sp|Q7U9I5|PTH_SYNPX Peptidyl-tRNA hydrolase OS=Synechococcus sp. (strain WH8102) GN=pth PE=3 SV=1 7 171 7.0E-07
sp|Q6ADQ8|PTH_LEIXX Peptidyl-tRNA hydrolase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pth PE=3 SV=1 7 189 7.0E-07
sp|Q2RMC1|PTH_MOOTA Peptidyl-tRNA hydrolase OS=Moorella thermoacetica (strain ATCC 39073) GN=pth PE=3 SV=1 6 167 9.0E-07
sp|Q4JU38|PTH2_CORJK Peptidyl-tRNA hydrolase 2 OS=Corynebacterium jeikeium (strain K411) GN=pth2 PE=3 SV=1 2 164 1.0E-06
sp|B7N415|PTH_ECOLU Peptidyl-tRNA hydrolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pth PE=3 SV=1 7 193 1.0E-06
sp|Q98PE2|PTH_MYCPU Peptidyl-tRNA hydrolase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=pth PE=3 SV=1 7 186 1.0E-06
sp|C0R594|PTH_WOLWR Peptidyl-tRNA hydrolase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=pth PE=3 SV=1 7 167 1.0E-06
sp|A7MNK0|PTH_CROS8 Peptidyl-tRNA hydrolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pth PE=3 SV=1 7 200 1.0E-06
sp|Q48MW1|PTH_PSE14 Peptidyl-tRNA hydrolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pth PE=3 SV=1 7 178 1.0E-06
sp|Q0S4R3|PTH_RHOJR Peptidyl-tRNA hydrolase OS=Rhodococcus jostii (strain RHA1) GN=pth PE=3 SV=1 7 175 1.0E-06
sp|Q888C8|PTH_PSESM Peptidyl-tRNA hydrolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pth PE=3 SV=1 7 178 1.0E-06
sp|Q3AUQ0|PTH_SYNS9 Peptidyl-tRNA hydrolase OS=Synechococcus sp. (strain CC9902) GN=pth PE=3 SV=1 7 150 1.0E-06
sp|Q4ZXX4|PTH_PSEU2 Peptidyl-tRNA hydrolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pth PE=3 SV=1 7 178 1.0E-06
sp|A7IIK5|PTH_XANP2 Peptidyl-tRNA hydrolase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pth PE=3 SV=1 6 171 1.0E-06
sp|P49607|PTH_CHLMU Peptidyl-tRNA hydrolase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pth PE=3 SV=3 7 178 2.0E-06
sp|B5FBW5|PTH_VIBFM Peptidyl-tRNA hydrolase OS=Vibrio fischeri (strain MJ11) GN=pth PE=3 SV=1 1 186 2.0E-06
sp|Q7NN75|PTH_GLOVI Peptidyl-tRNA hydrolase OS=Gloeobacter violaceus (strain PCC 7421) GN=pth PE=3 SV=1 7 174 2.0E-06
sp|A1UZN8|PTH_BURMS Peptidyl-tRNA hydrolase OS=Burkholderia mallei (strain SAVP1) GN=pth PE=3 SV=1 7 150 2.0E-06
sp|Q62FC1|PTH_BURMA Peptidyl-tRNA hydrolase OS=Burkholderia mallei (strain ATCC 23344) GN=pth PE=3 SV=1 7 150 2.0E-06
sp|Q82HE5|PTH_STRAW Peptidyl-tRNA hydrolase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=pth PE=3 SV=1 3 175 2.0E-06
sp|Q8NRV3|PTH1_CORGL Peptidyl-tRNA hydrolase 1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pth1 PE=3 SV=1 1 159 2.0E-06
sp|C1AY15|PTH_RHOOB Peptidyl-tRNA hydrolase OS=Rhodococcus opacus (strain B4) GN=pth PE=3 SV=1 7 175 2.0E-06
sp|Q110N1|PTH_TRIEI Peptidyl-tRNA hydrolase OS=Trichodesmium erythraeum (strain IMS101) GN=pth PE=3 SV=1 7 172 2.0E-06
sp|B8DTI5|PTH_BIFA0 Peptidyl-tRNA hydrolase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=pth PE=3 SV=1 1 182 3.0E-06
sp|Q30ZH1|PTH_DESAG Peptidyl-tRNA hydrolase OS=Desulfovibrio alaskensis (strain G20) GN=pth PE=3 SV=1 7 175 3.0E-06
sp|Q2SLA3|PTH_HAHCH Peptidyl-tRNA hydrolase OS=Hahella chejuensis (strain KCTC 2396) GN=pth PE=3 SV=1 1 197 4.0E-06
sp|A9B7I9|PTH_HERA2 Peptidyl-tRNA hydrolase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pth PE=3 SV=1 6 174 4.0E-06
sp|Q4L3F9|PTH_STAHJ Peptidyl-tRNA hydrolase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pth PE=3 SV=1 8 190 4.0E-06
sp|Q4FVB5|PTH_PSYA2 Peptidyl-tRNA hydrolase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pth PE=3 SV=1 7 179 5.0E-06
sp|A4Y9D9|PTH_SHEPC Peptidyl-tRNA hydrolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pth PE=3 SV=1 7 185 6.0E-06
sp|Q4JU39|PTH1_CORJK Peptidyl-tRNA hydrolase 1 OS=Corynebacterium jeikeium (strain K411) GN=pth1 PE=3 SV=2 6 153 7.0E-06
sp|Q8PNT8|PTH_XANAC Peptidyl-tRNA hydrolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pth PE=3 SV=1 7 165 8.0E-06
sp|Q3BX00|PTH_XANC5 Peptidyl-tRNA hydrolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pth PE=3 SV=1 7 165 8.0E-06
sp|A8AFY6|PTH_CITK8 Peptidyl-tRNA hydrolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pth PE=3 SV=1 7 196 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004045 aminoacyl-tRNA hydrolase activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5127
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1557
Ophiocordyceps camponoti-floridani Ophcf2|00514
Ophiocordyceps camponoti-rufipedis Ophun1|5484 (this protein)
Ophiocordyceps kimflemingae Ophio5|1238
Ophiocordyceps subramaniannii Hirsu2|3443

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5484
MFNPHFLVVSLGNPLPKYDTLHSAGHYVLKGLASALGHAPLRETRLGGLPVCFASNGAKHTLMQSPVLMNTSGKF
VADAWRHMCRQHRPDSLSLVLVHDELESADGVVSLLSWARSARGHRGVKDVHARLRQEAFPTSPLARIAVGIGRP
EGRDNATVVDYVMSRISASSKRNLEGAFANEAANSLARLEDYWQAELADGREDPGLGWSKRMSKNR*
Coding >Ophun1|5484
ATGTTCAATCCGCACTTCCTCGTCGTCAGCCTGGGAAACCCGCTGCCAAAGTATGACACGCTGCACTCGGCCGGC
CACTACGTCCTCAAGGGCCTCGCCAGCGCCTTGGGTCATGCCCCTTTGCGCGAGACCAGACTCGGCGGTCTACCG
GTCTGCTTTGCGTCCAACGGAGCCAAGCACACGCTGATGCAGTCGCCTGTGCTCATGAACACATCCGGAAAGTTC
GTCGCCGACGCCTGGCGCCACATGTGCCGGCAGCATCGTCCGGATTCTCTCAGCCTCGTCCTCGTCCACGACGAG
CTCGAGTCGGCAGATGGCGTCGTCTCGCTCCTCTCCTGGGCCCGCAGCGCTCGCGGACACCGAGGCGTCAAAGAC
GTTCACGCCCGGCTGCGGCAGGAAGCCTTCCCGACCTCTCCCTTGGCCCGTATAGCCGTTGGAATCGGACGGCCG
GAAGGACGGGACAATGCAACTGTGGTTGACTATGTCATGTCTCGCATCTCCGCCTCGTCCAAGCGGAACCTGGAG
GGAGCCTTTGCCAACGAGGCGGCCAACTCCCTAGCTAGACTGGAAGATTACTGGCAGGCCGAGCTTGCGGACGGA
CGAGAGGACCCTGGGCTCGGCTGGTCGAAGAGGATGTCAAAAAACCGATGA
Transcript >Ophun1|5484
ATGTTCAATCCGCACTTCCTCGTCGTCAGCCTGGGAAACCCGCTGCCAAAGTATGACACGCTGCACTCGGCCGGC
CACTACGTCCTCAAGGGCCTCGCCAGCGCCTTGGGTCATGCCCCTTTGCGCGAGACCAGACTCGGCGGTCTACCG
GTCTGCTTTGCGTCCAACGGAGCCAAGCACACGCTGATGCAGTCGCCTGTGCTCATGAACACATCCGGAAAGTTC
GTCGCCGACGCCTGGCGCCACATGTGCCGGCAGCATCGTCCGGATTCTCTCAGCCTCGTCCTCGTCCACGACGAG
CTCGAGTCGGCAGATGGCGTCGTCTCGCTCCTCTCCTGGGCCCGCAGCGCTCGCGGACACCGAGGCGTCAAAGAC
GTTCACGCCCGGCTGCGGCAGGAAGCCTTCCCGACCTCTCCCTTGGCCCGTATAGCCGTTGGAATCGGACGGCCG
GAAGGACGGGACAATGCAACTGTGGTTGACTATGTCATGTCTCGCATCTCCGCCTCGTCCAAGCGGAACCTGGAG
GGAGCCTTTGCCAACGAGGCGGCCAACTCCCTAGCTAGACTGGAAGATTACTGGCAGGCCGAGCTTGCGGACGGA
CGAGAGGACCCTGGGCTCGGCTGGTCGAAGAGGATGTCAAAAAACCGATGA
Gene >Ophun1|5484
ATGTTCAATCCGCACTTCCTCGTCGTCAGCCTGGGAAACCCGCTGCCAAAGTATGACACGCTGCACTCGGCCGGC
CACTACGTCCTCAAGGGCCTCGCCAGCGCCTTGGGTCATGCCCCTTTGCGCGAGACCAGACTCGGCGGTCTACCG
GTCTGCTTTGCGTCCAACGGAGCCAAGCACACGCTGATGCAGTCGCCTGTGCTCATGAACACATCCGGAAAGTTC
GTCGCCGACGCCTGGCGCCACATGTGCCGGCAGCATCGTCCGGATTCTCTCAGCCTCGTCCTCGTCCACGACGAG
CTCGAGTCGGCAGATGGCGTCGTCTCGCTCCTCTCCTGGGCCCGCAGCGCTCGCGGACACCGAGGCGTCAAAGAC
GTTCACGCCCGGCTGCGGCAGGAAGCCTTCCCGACCTCTCCCTTGGCCCGTATAGCCGTTGGAATCGGACGGCCG
GAAGGACGGGACAATGCAACTGTGGTTGACTATGTCATGTCTCGCATCTCCGCCTCGTCCAAGCGGAACCTGGAG
GGAGCCTTTGCCAACGAGGCGGCCAACTCCCTAGCTAGACTGGAAGATTACTGGCAGGCCGAGCTTGCGGACGGA
CGAGAGGACCCTGGGCTCGGCTGGTCGAAGAGGATGTCAAAAAACCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail