Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5474
Gene name
LocationContig_542:4819..7825
Strand+
Gene length (bp)3006
Transcript length (bp)2565
Coding sequence length (bp)2565
Protein length (aa) 855

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04828 GFA Glutathione-dependent formaldehyde-activating enzyme 7.5E-07 52 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13492|FOLE_NEUCR Folylpolyglutamate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-6 PE=1 SV=2 380 854 0.0E+00
sp|E7NMM0|FOLE_YEASO Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain FostersO) GN=MET7 PE=3 SV=2 391 853 9.0E-107
sp|E7KIA3|FOLE_YEASA Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain AWRI796) GN=MET7 PE=3 SV=2 391 853 2.0E-106
sp|E7QKX4|FOLE_YEASZ Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=MET7 PE=3 SV=2 391 853 2.0E-106
sp|Q08645|FOLE_YEAST Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET7 PE=1 SV=1 391 853 2.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13492|FOLE_NEUCR Folylpolyglutamate synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=met-6 PE=1 SV=2 380 854 0.0E+00
sp|E7NMM0|FOLE_YEASO Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain FostersO) GN=MET7 PE=3 SV=2 391 853 9.0E-107
sp|E7KIA3|FOLE_YEASA Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain AWRI796) GN=MET7 PE=3 SV=2 391 853 2.0E-106
sp|E7QKX4|FOLE_YEASZ Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=MET7 PE=3 SV=2 391 853 2.0E-106
sp|Q08645|FOLE_YEAST Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET7 PE=1 SV=1 391 853 2.0E-106
sp|E7KUJ4|FOLE_YEASL Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=MET7 PE=3 SV=2 391 853 2.0E-106
sp|C8ZGZ3|FOLE_YEAS8 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MET7 PE=3 SV=1 391 853 2.0E-106
sp|A6ZP80|FOLE_YEAS7 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain YJM789) GN=MET7 PE=3 SV=1 391 853 2.0E-106
sp|B3LJR0|FOLE_YEAS1 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MET7 PE=3 SV=1 391 853 2.0E-106
sp|E7Q9C7|FOLE_YEASB Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain FostersB) GN=MET7 PE=3 SV=2 391 853 1.0E-105
sp|B5VSC3|FOLE_YEAS6 Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MET7 PE=3 SV=2 391 853 7.0E-105
sp|Q9Y893|FOLE_CANAX Folylpolyglutamate synthase OS=Candida albicans GN=MET7 PE=3 SV=1 392 849 2.0E-99
sp|O74742|FOLE_SCHPO Probable folylpolyglutamate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met7 PE=2 SV=1 384 851 5.0E-96
sp|A6H751|FOLC_BOVIN Folylpolyglutamate synthase, mitochondrial OS=Bos taurus GN=FPGS PE=2 SV=1 394 849 1.0E-77
sp|Q05932|FOLC_HUMAN Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens GN=FPGS PE=1 SV=3 394 851 2.0E-76
sp|Q924L9|FOLC_CRIGR Folylpolyglutamate synthase, mitochondrial OS=Cricetulus griseus GN=FPGS PE=2 SV=1 394 849 3.0E-73
sp|P48760|FOLC_MOUSE Folylpolyglutamate synthase, mitochondrial OS=Mus musculus GN=Fpgs PE=1 SV=3 394 849 3.0E-71
sp|F4K2A1|FPGS1_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS1 PE=1 SV=1 381 850 4.0E-63
sp|Q09509|FOLC_CAEEL Putative folylpolyglutamate synthase OS=Caenorhabditis elegans GN=F25B5.6 PE=3 SV=1 381 847 6.0E-60
sp|Q8W035|FPGS3_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS3 PE=1 SV=1 390 766 1.0E-56
sp|F4J2K2|FPGS2_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana GN=FPGS2 PE=1 SV=1 393 714 1.0E-51
sp|Q54CY5|FOLC_DICDI Putative folylpolyglutamate synthase OS=Dictyostelium discoideum GN=folC PE=3 SV=1 392 848 2.0E-44
sp|Q05865|FOLC_BACSU Folylpolyglutamate synthase OS=Bacillus subtilis (strain 168) GN=folC PE=3 SV=2 437 706 2.0E-28
sp|F4JYE9|DHFS_ARATH Dihydrofolate synthetase OS=Arabidopsis thaliana GN=DHFS PE=1 SV=1 437 592 7.0E-23
sp|P15925|FOLC_LACCA Folylpolyglutamate synthase OS=Lactobacillus casei GN=fgs PE=1 SV=1 437 706 5.0E-20
sp|D4GW05|FOLCP_HALVD Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=folCP PE=3 SV=1 437 704 5.0E-20
sp|P08192|FOLC_ECOLI Bifunctional protein FolC OS=Escherichia coli (strain K12) GN=folC PE=1 SV=2 437 623 3.0E-19
sp|Q8K9X3|FOLC_BUCAP Bifunctional protein FolC OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=folC PE=3 SV=1 419 623 3.0E-19
sp|Q12676|FOLD_YEAST Dihydrofolate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL3 PE=1 SV=1 437 628 4.0E-19
sp|P43775|FOLC_HAEIN Folylpolyglutamate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folC PE=3 SV=1 437 623 1.0E-18
sp|Q9HS44|FOLCP_HALSA Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=folP PE=3 SV=1 437 702 1.0E-17
sp|Q9UTD0|FOLD_SCHPO Probable dihydrofolate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol3 PE=3 SV=1 437 592 7.0E-17
sp|P57265|FOLC_BUCAI Bifunctional protein FolC OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=folC PE=3 SV=1 437 623 6.0E-14
sp|Q89AT2|FOLC_BUCBP Bifunctional protein FolC OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=folC PE=3 SV=1 437 623 7.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0016846 carbon-sulfur lyase activity Yes
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup129
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2995
Ophiocordyceps australis 1348a (Ghana) OphauG2|2996
Ophiocordyceps australis map64 (Brazil) OphauB2|6104
Ophiocordyceps australis map64 (Brazil) OphauB2|6105
Ophiocordyceps camponoti-floridani Ophcf2|02321
Ophiocordyceps camponoti-floridani Ophcf2|02322
Ophiocordyceps camponoti-rufipedis Ophun1|5474 (this protein)
Ophiocordyceps kimflemingae Ophio5|4401
Ophiocordyceps kimflemingae Ophio5|4402
Ophiocordyceps subramaniannii Hirsu2|1045
Ophiocordyceps subramaniannii Hirsu2|2964
Ophiocordyceps subramaniannii Hirsu2|6309
Ophiocordyceps subramaniannii Hirsu2|9584

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5474
MTQDNDGTVAHEDQKSTAQAAEKTRTLRAECLCGKVRMSLEVPVSRLPVVAYLCHCSKCRYGTGSPCIFHTMLPE
GTRPSFVDESSLGSYLAPGAKYSYEFCSTCGCHIGGVSIDRKIWTVTPSIFKDYGPDTFQIRNHVFSSSAKGGGL
SSIVTHMGDQPINSWNPDPNDETAKLVECEPEVGPDGSDRLRARCWCGGVSFTVSRPTTEVLDDTFMSRFVSPRD
PRKWKAVIDACDDCRLVTGTHVIGWAFVPLAVCEPAIGVDLAIGTSQTYASSDGVLRSFCRVCGATVFFSCKRRQ
PSEKQAVVDLAIGILRAPDGVMAEDWLTWRARPSFADSGLRFDREFAEALNSGMKAWILTNWQPRMIRIRSFGLG
RGPVHHQFRRAMASSARSYNDALDALNSLQTPFAVIEARRKAGERPDEASLEEMRCYLRRLGKGSTCAYVDSILG
RYRQAYGVPRSVGLFTSPHLVAVRERIRIDSKPISEDMFAKYFFQVYDGLGASTDDSCVPPGSRPIYSRFLTLMS
WHVFLSERVDVAVYETGVGGAFDATNVIESPVAAGISTIGIDHTFALGDTLKQIAWHKAGIIKTGRPAFTISQAP
EAAEVIRQRAAEKGAVLKKLDVDARLLDGVRIRPDVDFQRKNATLAIALAEQALDKLGMAPKPGAALTPEFIDGL
EQTEIRGRCEVKAEDGLTWYIDGAHTPDSLEVSSKWFANETADCPGPRIFIFNQQSRSEAVDFLNAIHAAASRHR
VGKPCFDHVVFCTNVTHASSNRRDFFNRQVDPDSIDKLTVQRRFAQRWAELDPAAQVVVLPSVAEAIGHARQFAV
GGETALAYVTGSLHLVGGVLSILEEADAL*
Coding >Ophun1|5474
ATGACGCAGGACAACGACGGAACCGTGGCCCACGAGGACCAGAAAAGCACGGCTCAGGCGGCCGAAAAGACCAGG
ACGCTGAGGGCCGAATGCCTCTGCGGCAAGGTGCGCATGTCGCTCGAGGTGCCCGTCTCACGACTGCCGGTGGTC
GCCTACCTCTGCCACTGCAGCAAGTGCCGGTATGGAACGGGCTCGCCCTGCATCTTCCATACCATGTTGCCCGAG
GGCACGCGTCCCAGCTTCGTCGATGAATCCAGCCTGGGCTCGTACCTGGCACCGGGCGCCAAGTACAGCTACGAA
TTCTGCTCGACCTGCGGCTGTCACATCGGCGGCGTCAGCATCGATCGCAAGATATGGACCGTGACGCCGTCCATC
TTCAAAGACTACGGCCCGGATACATTTCAGATCCGCAACCATGTCTTCAGCTCCAGTGCCAAAGGCGGCGGCCTG
TCGTCCATCGTCACCCACATGGGCGACCAGCCCATCAATAGCTGGAACCCGGATCCGAATGATGAGACGGCCAAG
CTGGTCGAATGCGAGCCCGAGGTCGGTCCGGACGGCTCCGACAGGTTGCGGGCCCGGTGCTGGTGCGGCGGCGTG
TCGTTTACCGTGTCGAGGCCAACAACTGAGGTGCTAGACGACACCTTCATGTCGCGCTTCGTCTCGCCTCGGGAC
CCGCGCAAATGGAAAGCCGTCATCGACGCGTGCGACGACTGCCGCCTCGTCACGGGAACGCACGTCATCGGCTGG
GCTTTTGTGCCACTGGCCGTATGCGAGCCGGCCATTGGCGTGGACCTGGCCATCGGCACCTCTCAGACGTACGCC
TCGTCTGACGGCGTCCTGCGCTCCTTTTGCCGCGTCTGCGGCGCCACCGTCTTCTTCTCCTGCAAGAGGCGCCAA
CCTTCGGAGAAACAGGCCGTCGTCGATCTGGCCATCGGTATCTTGCGCGCGCCGGACGGCGTCATGGCCGAGGAC
TGGCTCACGTGGCGGGCGAGGCCCTCTTTTGCCGACAGCGGCCTCCGCTTCGATCGCGAGTTTGCCGAGGCTCTG
AACAGCGGAATGAAGGCATGGATCCTCACCAACTGGCAACCCCGGATGATTCGTATTAGGAGCTTCGGGCTCGGC
CGCGGGCCGGTCCATCACCAGTTCCGGAGAGCCATGGCTTCGTCCGCCAGATCGTACAACGACGCTCTCGATGCC
CTCAACTCGCTGCAGACGCCCTTCGCCGTCATCGAGGCTCGGCGCAAGGCGGGCGAGAGGCCCGACGAGGCCAGC
CTGGAAGAGATGCGCTGTTATCTCAGACGACTGGGCAAAGGCAGCACCTGCGCCTACGTCGACTCTATTCTCGGC
CGCTATCGACAGGCGTACGGCGTGCCTCGCAGCGTCGGCCTCTTCACGTCTCCTCATCTCGTCGCCGTGCGCGAG
CGGATACGCATCGACTCCAAGCCCATCTCAGAGGACATGTTTGCCAAGTACTTCTTCCAAGTCTACGATGGCCTC
GGCGCATCGACCGACGATTCGTGCGTGCCGCCGGGATCGCGGCCCATCTACAGCCGCTTCTTGACGCTCATGAGC
TGGCACGTTTTCCTCAGCGAGCGCGTCGACGTGGCCGTCTACGAGACGGGAGTTGGCGGCGCCTTTGACGCGACA
AACGTCATTGAGAGCCCCGTCGCGGCTGGCATCAGCACTATTGGCATCGACCACACTTTCGCCCTCGGAGACACC
CTAAAGCAGATTGCCTGGCACAAGGCCGGCATCATCAAGACTGGCAGACCGGCCTTTACCATCTCTCAGGCGCCG
GAAGCCGCCGAGGTCATCCGCCAGCGCGCGGCCGAAAAGGGCGCCGTACTGAAAAAGCTCGATGTCGACGCCCGG
CTGCTGGACGGCGTGCGCATCCGACCTGACGTCGACTTCCAGCGCAAGAATGCGACGCTGGCCATTGCCCTTGCG
GAGCAGGCCCTCGACAAGCTGGGCATGGCTCCGAAGCCGGGCGCGGCGCTGACTCCCGAATTCATCGACGGTCTG
GAGCAAACGGAGATTCGCGGCCGGTGCGAGGTCAAGGCCGAGGACGGATTGACGTGGTATATCGACGGCGCGCAC
ACGCCGGACAGCCTCGAGGTGTCGTCCAAGTGGTTTGCCAACGAGACGGCCGACTGCCCCGGCCCGAGAATCTTC
ATCTTCAACCAGCAGAGCCGGTCAGAAGCCGTCGACTTCCTGAACGCGATCCACGCAGCCGCGAGCCGCCACCGG
GTCGGCAAGCCGTGCTTCGACCACGTCGTCTTCTGCACAAACGTCACCCACGCCTCCAGCAACCGACGCGACTTT
TTCAACCGACAGGTCGATCCAGACTCCATCGACAAGCTGACGGTGCAGCGACGATTCGCCCAGAGGTGGGCCGAG
CTGGATCCGGCCGCTCAGGTGGTCGTCTTGCCGTCCGTTGCCGAGGCCATCGGCCATGCGAGACAGTTCGCCGTC
GGGGGAGAGACGGCGCTGGCGTACGTGACGGGTAGCCTGCACCTGGTTGGAGGCGTGCTGAGCATCCTGGAAGAG
GCGGACGCCTTGTAG
Transcript >Ophun1|5474
ATGACGCAGGACAACGACGGAACCGTGGCCCACGAGGACCAGAAAAGCACGGCTCAGGCGGCCGAAAAGACCAGG
ACGCTGAGGGCCGAATGCCTCTGCGGCAAGGTGCGCATGTCGCTCGAGGTGCCCGTCTCACGACTGCCGGTGGTC
GCCTACCTCTGCCACTGCAGCAAGTGCCGGTATGGAACGGGCTCGCCCTGCATCTTCCATACCATGTTGCCCGAG
GGCACGCGTCCCAGCTTCGTCGATGAATCCAGCCTGGGCTCGTACCTGGCACCGGGCGCCAAGTACAGCTACGAA
TTCTGCTCGACCTGCGGCTGTCACATCGGCGGCGTCAGCATCGATCGCAAGATATGGACCGTGACGCCGTCCATC
TTCAAAGACTACGGCCCGGATACATTTCAGATCCGCAACCATGTCTTCAGCTCCAGTGCCAAAGGCGGCGGCCTG
TCGTCCATCGTCACCCACATGGGCGACCAGCCCATCAATAGCTGGAACCCGGATCCGAATGATGAGACGGCCAAG
CTGGTCGAATGCGAGCCCGAGGTCGGTCCGGACGGCTCCGACAGGTTGCGGGCCCGGTGCTGGTGCGGCGGCGTG
TCGTTTACCGTGTCGAGGCCAACAACTGAGGTGCTAGACGACACCTTCATGTCGCGCTTCGTCTCGCCTCGGGAC
CCGCGCAAATGGAAAGCCGTCATCGACGCGTGCGACGACTGCCGCCTCGTCACGGGAACGCACGTCATCGGCTGG
GCTTTTGTGCCACTGGCCGTATGCGAGCCGGCCATTGGCGTGGACCTGGCCATCGGCACCTCTCAGACGTACGCC
TCGTCTGACGGCGTCCTGCGCTCCTTTTGCCGCGTCTGCGGCGCCACCGTCTTCTTCTCCTGCAAGAGGCGCCAA
CCTTCGGAGAAACAGGCCGTCGTCGATCTGGCCATCGGTATCTTGCGCGCGCCGGACGGCGTCATGGCCGAGGAC
TGGCTCACGTGGCGGGCGAGGCCCTCTTTTGCCGACAGCGGCCTCCGCTTCGATCGCGAGTTTGCCGAGGCTCTG
AACAGCGGAATGAAGGCATGGATCCTCACCAACTGGCAACCCCGGATGATTCGTATTAGGAGCTTCGGGCTCGGC
CGCGGGCCGGTCCATCACCAGTTCCGGAGAGCCATGGCTTCGTCCGCCAGATCGTACAACGACGCTCTCGATGCC
CTCAACTCGCTGCAGACGCCCTTCGCCGTCATCGAGGCTCGGCGCAAGGCGGGCGAGAGGCCCGACGAGGCCAGC
CTGGAAGAGATGCGCTGTTATCTCAGACGACTGGGCAAAGGCAGCACCTGCGCCTACGTCGACTCTATTCTCGGC
CGCTATCGACAGGCGTACGGCGTGCCTCGCAGCGTCGGCCTCTTCACGTCTCCTCATCTCGTCGCCGTGCGCGAG
CGGATACGCATCGACTCCAAGCCCATCTCAGAGGACATGTTTGCCAAGTACTTCTTCCAAGTCTACGATGGCCTC
GGCGCATCGACCGACGATTCGTGCGTGCCGCCGGGATCGCGGCCCATCTACAGCCGCTTCTTGACGCTCATGAGC
TGGCACGTTTTCCTCAGCGAGCGCGTCGACGTGGCCGTCTACGAGACGGGAGTTGGCGGCGCCTTTGACGCGACA
AACGTCATTGAGAGCCCCGTCGCGGCTGGCATCAGCACTATTGGCATCGACCACACTTTCGCCCTCGGAGACACC
CTAAAGCAGATTGCCTGGCACAAGGCCGGCATCATCAAGACTGGCAGACCGGCCTTTACCATCTCTCAGGCGCCG
GAAGCCGCCGAGGTCATCCGCCAGCGCGCGGCCGAAAAGGGCGCCGTACTGAAAAAGCTCGATGTCGACGCCCGG
CTGCTGGACGGCGTGCGCATCCGACCTGACGTCGACTTCCAGCGCAAGAATGCGACGCTGGCCATTGCCCTTGCG
GAGCAGGCCCTCGACAAGCTGGGCATGGCTCCGAAGCCGGGCGCGGCGCTGACTCCCGAATTCATCGACGGTCTG
GAGCAAACGGAGATTCGCGGCCGGTGCGAGGTCAAGGCCGAGGACGGATTGACGTGGTATATCGACGGCGCGCAC
ACGCCGGACAGCCTCGAGGTGTCGTCCAAGTGGTTTGCCAACGAGACGGCCGACTGCCCCGGCCCGAGAATCTTC
ATCTTCAACCAGCAGAGCCGGTCAGAAGCCGTCGACTTCCTGAACGCGATCCACGCAGCCGCGAGCCGCCACCGG
GTCGGCAAGCCGTGCTTCGACCACGTCGTCTTCTGCACAAACGTCACCCACGCCTCCAGCAACCGACGCGACTTT
TTCAACCGACAGGTCGATCCAGACTCCATCGACAAGCTGACGGTGCAGCGACGATTCGCCCAGAGGTGGGCCGAG
CTGGATCCGGCCGCTCAGGTGGTCGTCTTGCCGTCCGTTGCCGAGGCCATCGGCCATGCGAGACAGTTCGCCGTC
GGGGGAGAGACGGCGCTGGCGTACGTGACGGGTAGCCTGCACCTGGTTGGAGGCGTGCTGAGCATCCTGGAAGAG
GCGGACGCCTTGTAG
Gene >Ophun1|5474
ATGACGCAGGACAACGACGGAACCGTGGCCCACGAGGACCAGAAAAGCACGGCTCAGGCGGCCGAAAAGACCAGG
ACGCTGAGGGCCGAATGCCTCTGCGGCAAGGTGCGCATGTCGCTCGAGGTGCCCGTCTCACGACTGCCGGTGGTC
GCCTACCTCTGCCACTGCAGCAAGTGCCGGTATGGAACGGGCTCGCCCTGCATCTTCCATACCATGTTGCCCGAG
GGCACGCGTCCCAGCTTCGTCGATGAATCCAGCCTGGGCTCGTACCTGGCACCGGGCGCCAAGTACAGCTACGAA
TTCTGCTCGACCTGCGGCTGTCACATCGGCGGCGTCAGCATCGATCGCAAGATATGGACCGTGACGCCGTCCATC
TTCAAAGACTACGGCCCGGATACATTTCAGATCCGCAACCATGTCTTCAGCTCCAGTGCCAAAGGCGGCGGCCTG
TCGTCCATCGTCACCCACATGGGCGACCAGCCCATCAATAGCTGGAACCCGGATCCGAATGATGAGACGGCCAAG
CTGGTCGAATGCGAGCCCGAGGTCGGTCCGGACGGCTCCGACAGGTTGCGGGCCCGGTGCTGGTGCGGCGGCGTG
TCGTTTACCGTGTCGAGGCCAACAACTGAGGTGCTAGACGACACCTTCATGTCGCGCTTCGTCTCGCCTCGGGAC
CCGCGCAAATGGAAAGCCGTCATCGACGCGTGCGACGACTGCCGCCTCGTCACGGGAACGCACGTCATCGGCTGG
GCTTTTGTGCCACTGGCCGTATGCGAGCCGGCCATTGGCGTGGACCTGGCCATCGGCACCTCTCAGACGTACGCC
TCGTCTGACGGCGTCCTGCGCTCCTTTTGCCGCGTCTGCGGCGCCACCGTCTTCTTCTCCTGCAAGAGGCGCCAA
CCTTCGGAGAAACAGGCCGTCGTCGATCTGGCCATCGGTATCTTGCGCGCGCCGGACGGCGTCATGGCCGAGGAC
TGGCTCACGTGGCGGGCGAGGCCCTCTTTTGCCGACAGCGGCCTCCGCTTCGATCGCGAGTTTGCCGAGGCTCTG
AACAGCGGAATGAAGGCATGGAGTGAGAAGAGATATGGGGAGGCGATCGAGTTTGAAACCATGTAGTTTGATTTC
TTCCGAGATGAGTGAAGAAGCATGTCGTTGAGAAACGAGATTTCGTTATCGCCAGAAGATATCGTAGCGATGTGC
GAGTAGTGAACCTTATTTGAACACACAATCGTCACTCTGTTAATCGTTGATGCCTCAGGCACGCACACCTTCACA
GCTCTAAAAGAAGCTCCTCAGTCCTCACCAACTGGCAACCCCGGATGATTCGTATTAGGAGCTTCGGGCTCGGCC
GCGGGCCGGTCCATCACCAGTTCCGGAGAGCCATGGCTTCGTCCGCCAGATCGTACAACGTACCTCTCGGCCATA
CTACCTCACCGTCCTCTTGGCCGTCTAATATCAGCCGCAGGACGCTCTCGATGCCCTCAACTCGCTGCAGACGCC
CTTCGCCGTCATCGAGGCTCGGCGCAAGGCGGGCGAGAGGCCCGACGAGGCCAGCCTGGAAGAGATGCGCTGTTA
TCTCAGACGACTGGGTTACGAGGCGAGTCATCTAGCCTGCCTTTACTGCTCGCTGGCTGGCTGACACGATATGAA
GCCATCCCACCTCGCGGCTCTCAACGTGATCCACGTCGCCGGCACCAAAGGCAAAGGCAGCACCTGCGCCTACGT
CGACTCTATTCTCGGCCGCTATCGACAGGCGTACGGCGTGCCTCGCAGCGTCGGCCTCTTCACGTCTCCTCATCT
CGTCGCCGTGCGCGAGCGGATACGCATCGACTCCAAGCCCATCTCAGAGGACATGTTTGCCAAGTACTTCTTCCA
AGTCTACGATGGCCTCGGCGCATCGACCGACGATTCGTGCGTGCCGCCGGGATCGCGGCCCATCTACAGCCGCTT
CTTGACGCTCATGAGCTGGCACGTTTTCCTCAGCGAGCGCGTCGACGTGGCCGTCTACGAGACGGGAGTTGGCGG
CGCCTTTGACGCGACAAACGTCATTGAGAGCCCCGTCGCGGCTGGCATCAGCACTATTGGCATCGACCACACTTT
CGCCCTCGGAGACACCCTAAAGCAGATTGCCTGGCACAAGGCCGGCATCATCAAGACTGGCAGACCGGCCTTTAC
CATCTCTCAGGCGCCGGAAGCCGCCGAGGTCATCCGCCAGCGCGCGGCCGAAAAGGGCGCCGTACTGAAAAAGCT
CGATGTCGACGCCCGGCTGCTGGACGGCGTGCGCATCCGACCTGACGTCGACTTCCAGCGCAAGAATGCGACGCT
GGCCATTGCCCTTGCGGAGCAGGCCCTCGACAAGCTGGGCATGGCTCCGAAGCCGGGCGCGGCGCTGACTCCCGA
ATTCATCGACGGTCTGGAGCAAACGGAGATTCGCGGCCGGTGCGAGGTCAAGGCCGAGGACGGATTGACGTGGTA
TATCGACGGCGCGCACACGCCGGACAGCCTCGAGGTGTCGTCCAAGTGGTTTGCCAACGAGACGGCCGACTGGTA
CGTGATATGATCGCTACCATGGATTTGAGCTGATAAGAGCACCACAGCCCCGGCCCGAGAATCTTCATCTTCAAC
CAGCAGAGCCGGTCAGAAGCCGTCGACTTCCTGAACGCGATCCACGCAGCCGCGAGCCGCCACCGGGTCGGCAAG
CCGTGCTTCGACCACGTCGTCTTCTGCACAAACGTCACCCACGCCTCCAGCAACCGACGCGACTTTTTCAACCGA
CAGGTCGATCCAGACTCCATCGACAAGCTGACGGTGCAGCGACGATTCGCCCAGAGGTGGGCCGAGCTGGATCCG
GCCGCTCAGGTGGTCGTCTTGCCGTCCGTTGCCGAGGCCATCGGCCATGCGAGACAGTTCGCCGTCGGGGGAGAG
ACGGCGCTGGCGTACGTGACGGGTAGCCTGCACCTGGTTGGAGGCGTGCTGAGCATCCTGGAAGAGGCGGACGCC
TTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail