Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5470
Gene name
LocationContig_541:5878..7586
Strand+
Gene length (bp)1708
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 6.4E-08 168 243

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup16797
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|5470 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5470
MNKEDRGFGDYLHGIDPEGRASEWHVRHTVRYCEAHFLRAITAAVVGELLPRLASLIDLGGIKVAEQPLYVNDVM
TNRYQRDSTPDELFDVLLPEGYKLEPDKKSARLILQEDFSTRTQTKDLGLYAGSFDLAQLSGSKDYPSWALRMES
ALIREKLWPAVQQEGHNKAEEAKALLRLFVADGPLTQIKHIEDPCLIWKKLKELYNPSSFTSNLLLIGILFSVEY
KGRMEVYLNRLKNNYEELLSRSQLKASTVEELMLLKSGVKT*
Coding >Ophun1|5470
ATGAATAAGGAAGACCGGGGATTTGGAGACTACCTTCACGGCATAGACCCAGAAGGCCGGGCCTCAGAATGGCAC
GTTAGGCACACGGTGCGATACTGCGAGGCTCACTTCCTTCGTGCAATTACTGCTGCCGTGGTGGGCGAGCTTCTA
CCGAGGCTGGCAAGTCTGATCGATCTGGGTGGAATAAAGGTCGCCGAGCAACCTCTCTACGTCAATGATGTCATG
ACCAACCGCTACCAACGGGATTCGACCCCTGATGAGCTGTTTGATGTCTTGTTACCAGAGGGCTATAAGCTCGAA
CCGGATAAAAAGAGCGCTCGGCTGATTCTGCAAGAAGACTTTTCTACCCGAACGCAGACGAAAGACCTCGGACTG
TACGCAGGGAGTTTCGATCTCGCCCAGCTTTCTGGCTCCAAGGACTACCCCTCGTGGGCCCTTCGGATGGAATCA
GCTCTCATTCGTGAGAAGCTGTGGCCTGCTGTACAGCAAGAAGGTCATAATAAGGCAGAAGAAGCTAAGGCTTTG
TTGAGGCTCTTTGTTGCAGACGGGCCATTGACCCAGATCAAGCACATAGAAGACCCCTGTCTGATTTGGAAGAAG
CTCAAGGAGCTATATAATCCATCTTCCTTCACTTCCAACTTGCTACTTATAGGGATTCTCTTCTCTGTTGAATAC
AAAGGAAGAATGGAAGTCTATCTCAATAGACTCAAAAACAATTACGAAGAGCTATTGTCTAGAAGTCAACTCAAA
GCTAGTACAGTCGAAGAACTTATGCTGCTAAAATCAGGGGTCAAAACCTAA
Transcript >Ophun1|5470
ATGAATAAGGAAGACCGGGGATTTGGAGACTACCTTCACGGCATAGACCCAGAAGGCCGGGCCTCAGAATGGCAC
GTTAGGCACACGGTGCGATACTGCGAGGCTCACTTCCTTCGTGCAATTACTGCTGCCGTGGTGGGCGAGCTTCTA
CCGAGGCTGGCAAGTCTGATCGATCTGGGTGGAATAAAGGTCGCCGAGCAACCTCTCTACGTCAATGATGTCATG
ACCAACCGCTACCAACGGGATTCGACCCCTGATGAGCTGTTTGATGTCTTGTTACCAGAGGGCTATAAGCTCGAA
CCGGATAAAAAGAGCGCTCGGCTGATTCTGCAAGAAGACTTTTCTACCCGAACGCAGACGAAAGACCTCGGACTG
TACGCAGGGAGTTTCGATCTCGCCCAGCTTTCTGGCTCCAAGGACTACCCCTCGTGGGCCCTTCGGATGGAATCA
GCTCTCATTCGTGAGAAGCTGTGGCCTGCTGTACAGCAAGAAGGTCATAATAAGGCAGAAGAAGCTAAGGCTTTG
TTGAGGCTCTTTGTTGCAGACGGGCCATTGACCCAGATCAAGCACATAGAAGACCCCTGTCTGATTTGGAAGAAG
CTCAAGGAGCTATATAATCCATCTTCCTTCACTTCCAACTTGCTACTTATAGGGATTCTCTTCTCTGTTGAATAC
AAAGGAAGAATGGAAGTCTATCTCAATAGACTCAAAAACAATTACGAAGAGCTATTGTCTAGAAGTCAACTCAAA
GCTAGTACAGTCGAAGAACTTATGCTGCTAAAATCAGGGGTCAAAACCTAA
Gene >Ophun1|5470
ATGAATAAGGAAGACCGGGGTATGCTTGCGTGGATGTACAAGATAGTACATCAACTCCTACAGACACGCTTTAGC
ATCCAGCTAAAGTGGAAGCATATCCACGGCACGGGGCTCGTCGGGACTACCGCTGACCCCAACTTCAGGATTTGG
AGACTACCTTCACGGCATAGACCCAGAAGGCCGGGCCTCAGAATGGCACGTTAGGCACACGGTGCGATACTGCGA
GGCTCACTTCCTTCGTGGTATAGAGAAGCATTGCCCGCAGTGGATGACAAGTGGGAAACGGTAATGACACTTCGA
GACTACGGAGACCCTATGGATCTATGCCGCGAGCTGTGTCTGCACTTACATGGTAGCAATTACTGCTGCCGTGGT
GGGCGAGCTTCTACCGAGGCTGGCAAGTCTGATCGATCTGGGTGGAATAAAGGTCGCCGAGCAACCTCTCTACGT
CAATGGTTGGTGGATCGCCATATCTATACGACACTGCCTACCTACCTCTCTCCTTATTTTACCGTTCCTTTGATA
ACCCAACACCTCATTATTCGTGCATTCGATGAAGGAGATGGAGAGCTATTTACTCGTCGTTGCTCGATGCGGCAG
ATGTCATGACCAACCGCTACCAACGGGATTCGACCCCTGATGAGCTGTTTGATGTCTTGTTACCAGAGGGCTATA
AGCTCGAACCGGATAAAAAGAGCGTGCGGAAGAGGCGTCCAGAGACGAGTTATTTCACGAACAACAACGCGTACA
ACACTATAACGGCTGTAGTAACAGAACAAGCTGTGAAGCTGTCTACGAAGATCAAGCATGTCGATATTCACGGCC
CTTTTCATCCCTTCTCAAGGAAGTAAATAAAGGGCTGTGTCGTTGGGCGCATCGGAAAATCGTCACAGAAAGATT
CCAACAGCACAAGTTCACTCTTGGACGTTTCAGCCAAGTCTTTGGGCAATTAGCTCTATACGCAAGAAACATGGG
CTTTACCGCCGTCTTGATGGAGACCGACTCGTTGTCGCGCGGGAACAGGCTCGGCTGATTCTGCAAGAAGACTTT
TCTACCCGAACGCAGACGAAAGACCTCGGACGTACCCTGTTACACGTTTTCACGCAGCAAAGGAAAGCGATCTTG
GGCCGGGACGAGCTATACAAGCTGTACTTGCGCCCGAGAACGTTACCGAAAGATATCAGCAGCACAAGTTCACTC
GAGGAACCTTCTCTTGCCCTGGGCTGGACTTTGTTGGGTCGATTGACGCCTATGACAAGCTAAACAATGGGGATT
CGAAGTGTACGCAGGGAGTTTCGATCTCGCCCAGCTTTCTGGCTCCAAGGACTACCCCTCGTGGGCCCTTCGGAT
GGAATCAGCTCTCATTCGTGAGAAGCTGTGGCCTGCTGTACAGCAAGAAGGTCATAATAAGGCAGAAGAAGCTAA
GGCTTTGTTGAGGCTCTTTGTTGCAGACGGGCCATTGACCCAGATCAAGCACATAGAAGACCCCTGTCTGATTTG
GAAGAAGCTCAAGGAGCTATATAATCCATCTTCCTTCACTTCCAACTTGCTACTTATAGGGATTCTCTTCTCTGT
TGAATACAAAGGAAGAATGGAAGTCTATCTCAATAGACTCAAAAACAATTACGAAGAGCTATTGTCTAGAAGTCA
ACTCAAAGCTAGTACAGTCGAAGAACTTATGCTGCTAAAATCAGGGGTCAAAACCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail