Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5466
Gene name
LocationContig_540:2646..7721
Strand-
Gene length (bp)5075
Transcript length (bp)4956
Coding sequence length (bp)4956
Protein length (aa) 1652

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13001 Ecm29 Proteasome stabiliser 9.7E-135 14 509

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38737|ECM29_YEAST Proteasome component ECM29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM29 PE=1 SV=1 882 1613 8.0E-110
sp|Q5VYK3|ECM29_HUMAN Proteasome-associated protein ECM29 homolog OS=Homo sapiens GN=ECM29 PE=1 SV=2 823 1651 8.0E-104
sp|Q6PDI5|ECM29_MOUSE Proteasome-associated protein ECM29 homolog OS=Mus musculus GN=Ecm29 PE=1 SV=3 823 1651 4.0E-103
sp|Q5R6J0|ECM29_PONAB Proteasome-associated protein ECM29 homolog (Fragment) OS=Pongo abelii GN=ECM29 PE=2 SV=2 823 1651 2.0E-102
sp|Q9P7H8|ECM29_SCHPO Proteasome component ecm29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ecm29 PE=1 SV=1 870 1617 6.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38737|ECM29_YEAST Proteasome component ECM29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM29 PE=1 SV=1 882 1613 8.0E-110
sp|Q5VYK3|ECM29_HUMAN Proteasome-associated protein ECM29 homolog OS=Homo sapiens GN=ECM29 PE=1 SV=2 823 1651 8.0E-104
sp|Q6PDI5|ECM29_MOUSE Proteasome-associated protein ECM29 homolog OS=Mus musculus GN=Ecm29 PE=1 SV=3 823 1651 4.0E-103
sp|Q5R6J0|ECM29_PONAB Proteasome-associated protein ECM29 homolog (Fragment) OS=Pongo abelii GN=ECM29 PE=2 SV=2 823 1651 2.0E-102
sp|Q9P7H8|ECM29_SCHPO Proteasome component ecm29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ecm29 PE=1 SV=1 870 1617 6.0E-84
sp|Q9V677|ECM29_DROME Proteasome-associated protein ECM29 homolog OS=Drosophila melanogaster GN=CG8858 PE=1 SV=1 827 1621 7.0E-61
sp|P38737|ECM29_YEAST Proteasome component ECM29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM29 PE=1 SV=1 1 536 5.0E-26
sp|Q5VYK3|ECM29_HUMAN Proteasome-associated protein ECM29 homolog OS=Homo sapiens GN=ECM29 PE=1 SV=2 8 574 3.0E-12
sp|Q5R6J0|ECM29_PONAB Proteasome-associated protein ECM29 homolog (Fragment) OS=Pongo abelii GN=ECM29 PE=2 SV=2 35 574 3.0E-10
sp|Q6PDI5|ECM29_MOUSE Proteasome-associated protein ECM29 homolog OS=Mus musculus GN=Ecm29 PE=1 SV=3 19 162 2.0E-09
sp|Q9V677|ECM29_DROME Proteasome-associated protein ECM29 homolog OS=Drosophila melanogaster GN=CG8858 PE=1 SV=1 23 149 1.0E-06
sp|Q9P7H8|ECM29_SCHPO Proteasome component ecm29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ecm29 PE=1 SV=1 8 123 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043248 proteasome assembly Yes
GO:0060090 molecular adaptor activity Yes
GO:0043933 protein-containing complex organization No
GO:0065003 protein-containing complex assembly No
GO:0003674 molecular_function No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0022607 cellular component assembly No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4505
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7030
Ophiocordyceps australis map64 (Brazil) OphauB2|1436
Ophiocordyceps camponoti-floridani Ophcf2|03576
Ophiocordyceps camponoti-rufipedis Ophun1|5466 (this protein)
Ophiocordyceps kimflemingae Ophio5|4541
Ophiocordyceps subramaniannii Hirsu2|9402

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5466
MAAPPTEQRELQLVESLDFRILGIANHEEKLNELLQRFLAPLLLKAASEHSSVRTKVFQILGRLKTFTRPPSIVL
PVEKLLKQYKSNQSPVVKQLDLSFANHSLDRLDAKDRMELIPIVLGGLAAEETLPSAASMLNIVLRLLLDLEIPP
RGSKEDSAFREAIGLLNSADAEYLANVIGIFFRLRTPRESQALALSNPSLSQQELALFSTEKDESEKLFKRSSQL
KAKLVAFLASGAFTDEEKFLPALYAASGPDKRAASAAEEILKRSSVSLEDDSLIQRLFHAHSVSPAAGRSRILGM
LSKSTVSTRMSDRIIDVVEVDLDTDGSADSWQRPTSVLEQTRLHTALFLYLSWVARIGPSAPPFTVGRPLIKYMQ
SYIEKQGWPLPLVDTHDAVYLRSKAYETLGSLARTADLTVTERLDVGDWLFQSLSEDFTNDAVVSIDGALSTMSA
SIPPSIGGNNASLKRLLLMHMTLPEGAPAVRSTRHAAVKWANQCLPFSDILGRWIDILATAARPDERSDVVEQGA
KGLDPWTRSWNEDASPLPDWRDMVATFCDIGEDPNSRLLKRINGTSNPSPPPYDSFCTKRRSIVGAALRYCRLIL
FLTALDGSDQYPSSMQVLERQVRQDIPTRSRIREYLKLNGSYVNLYLRSCLWNARNSPSITEDCMDCFTDVASLS
PRESLESLLDGGFSSLLLQLVESRNKKISKLTARAVGMLIAHPACPAEDFDTWCFKLPLLITEATRRPAAEMDSV
EGGLMALAHLNSRSVYYDREFPKKTDYPFDLLVDEYSSSSLYETALYSFSELWTARLALPPADSVRKIVEKLTAQ
AKKGREKAVIALGHLSIGLEAAEKTEFTDTTGQNAETGASRTVLDTILDELFSLYDSGQAELQFSVGDAISCVAA
RWDSNTVAITMDVVPRNDRYFAPARSSVLEAVIGRLLRACMDTKPSLLRSASIWLLCLIMNCSHLDPVQSRLREV
QAAFMRLLAVKDEVVQETASRGLTLVYERGQGDLKASLVKDLVSAFTGSGTQLKVGEETELFDPGALPTGEGKSV
TSYKDIVALANEAGDQRLVYKFMSLAADAATWSTRSAFGRFGLSSILSEADMDPKLYMKLYRYRFDPNPNVQRSM
DAIWKAVVKDPNATLDKHFGAIMEDLLKSQLGREWRVREASCAALSSLISGRPFAQYEKYYREVWKTSLKVLDDV
KGSVREAARRLCMNLSNGVVRQLDEGNQSSVAKSMMREALPFLLSDKGMESTVKEVRMFATMTVLGICKKGGDAL
RPFIPETMTPLLGLLSTIEPQEINYHYQRVGEDGRDEIDRLRSQMVNQSPISEAIDDMLRFVDADVLAKLGPRLE
DTIKSAVGMPTKIGCSRVLTTLATRHTDLSLWASRFLRLLQKQVLDKNDEVSQSYARAAAYLWRKVSEKEQVDFC
EAFVNKYLAAEDERRRQKIADVILALAKISPDVFTANEGVILPFVYLGRHDTDEYTAKMFNEAWSQHAGSGRTVM
RYVTEIVALVEKCVDATQWSLRHTAAFTVAAMVQDVAKATDATGGISESMAREMWPALCKTLALKTFPGKEKLLE
SFCKFVEQGRALWTVDEEVAMLMTQIAVREAKRNNDEYRVHAFRCLRQYSKARDDLDMAQQVEAITKPYEDKMDV
D*
Coding >Ophun1|5466
ATGGCTGCCCCTCCGACTGAGCAGCGGGAGCTGCAGCTGGTCGAGAGCCTCGACTTCAGGATTCTCGGCATCGCC
AACCATGAAGAGAAGCTAAACGAGCTTCTTCAGCGCTTTCTTGCCCCGCTGCTTCTCAAGGCTGCCAGCGAGCAC
TCTTCTGTCCGGACAAAGGTTTTTCAAATACTGGGAAGACTCAAGACCTTCACACGGCCCCCAAGCATCGTTCTG
CCTGTCGAAAAGCTGCTCAAGCAGTACAAGTCGAATCAATCTCCAGTTGTTAAGCAACTGGATCTTTCTTTCGCC
AACCATAGTCTCGACCGATTGGACGCAAAAGATAGGATGGAGCTTATTCCCATCGTTCTAGGAGGACTCGCTGCT
GAAGAGACTCTGCCGAGCGCTGCGAGTATGCTCAATATTGTCCTTCGGCTGCTTCTTGACCTTGAGATACCACCC
CGGGGGAGCAAGGAGGATTCCGCCTTCAGGGAGGCGATTGGTCTCTTGAATAGTGCGGATGCTGAATATCTTGCC
AATGTAATTGGTATATTCTTCCGCTTGCGCACACCAAGGGAATCCCAGGCACTGGCCCTTTCGAATCCCTCTCTC
TCCCAGCAAGAGTTGGCTCTGTTCTCCACCGAAAAGGACGAAAGCGAGAAACTGTTCAAACGATCATCACAGTTG
AAAGCAAAGCTGGTCGCTTTTCTGGCCAGTGGTGCCTTTACAGATGAGGAGAAATTCCTGCCCGCTCTATACGCT
GCGTCCGGTCCCGACAAAAGAGCCGCCTCGGCTGCCGAAGAGATCCTCAAGAGGAGCTCGGTCTCACTGGAAGAC
GACTCACTGATTCAACGGCTTTTTCACGCGCACTCGGTTTCTCCGGCCGCCGGTCGCTCCCGCATACTGGGTATG
CTGAGCAAGTCTACCGTGTCGACGAGGATGTCAGACAGAATAATTGACGTCGTTGAGGTTGATCTCGACACCGAC
GGGTCCGCTGACTCGTGGCAGCGTCCAACCAGCGTTCTGGAGCAAACCCGACTTCATACGGCCTTGTTCCTGTAC
CTATCATGGGTCGCTCGAATCGGACCGTCGGCACCCCCCTTTACTGTTGGCCGGCCGCTCATCAAATACATGCAG
TCCTACATTGAAAAGCAGGGATGGCCTTTACCTCTGGTTGACACCCACGATGCAGTCTATTTGCGGTCCAAGGCC
TACGAAACACTCGGTTCGCTAGCAAGGACCGCCGACCTCACTGTTACCGAGCGACTAGACGTGGGAGATTGGCTT
TTCCAGTCTCTTTCGGAGGATTTCACGAATGACGCAGTGGTCAGCATCGACGGTGCTCTCTCTACCATGTCGGCT
AGTATCCCACCGAGCATTGGGGGCAACAACGCGTCTCTGAAAAGATTGCTGTTGATGCACATGACTCTTCCCGAG
GGAGCCCCTGCGGTCCGAAGCACGCGTCATGCTGCTGTCAAGTGGGCAAACCAATGTCTTCCCTTCTCTGACATC
CTGGGCCGATGGATCGACATTTTGGCAACGGCCGCGCGACCAGACGAACGCAGCGACGTGGTTGAACAGGGCGCC
AAAGGGCTGGATCCTTGGACGAGATCATGGAATGAGGATGCATCGCCTCTGCCCGATTGGAGGGATATGGTGGCA
ACTTTTTGCGACATTGGTGAAGACCCGAATAGCCGGCTACTTAAACGAATCAATGGGACGTCGAATCCTTCTCCT
CCCCCCTACGACAGCTTCTGCACAAAGCGGCGGTCGATTGTTGGCGCTGCGTTGCGATACTGCCGTCTCATCCTG
TTTCTTACGGCTCTCGACGGCTCTGATCAGTATCCGAGCAGCATGCAGGTGCTAGAAAGACAGGTCCGGCAAGAT
ATTCCCACCCGGTCGCGTATTCGAGAATACCTAAAACTCAACGGCTCGTATGTCAACCTCTACCTCAGGTCGTGC
TTGTGGAACGCCAGGAATTCTCCGTCCATCACGGAAGACTGCATGGACTGCTTCACGGATGTGGCTTCCCTCAGT
CCTAGGGAAAGTCTGGAATCCTTGCTTGATGGCGGATTCAGTTCGTTGTTGCTTCAGCTCGTGGAATCCAGGAAC
AAGAAGATCTCGAAGTTGACTGCGAGGGCCGTCGGCATGCTCATCGCTCACCCGGCCTGTCCAGCTGAAGACTTT
GACACCTGGTGTTTCAAACTGCCTCTGTTGATTACCGAAGCAACGCGGCGGCCTGCTGCAGAGATGGACTCTGTC
GAGGGCGGCTTGATGGCTCTCGCGCACCTAAACTCTCGCTCCGTCTATTATGACCGTGAATTTCCGAAGAAAACG
GATTATCCATTTGATCTTTTGGTTGATGAATATTCATCCTCTTCACTCTACGAGACCGCGCTCTATTCCTTTTCA
GAGCTCTGGACGGCAAGACTGGCTCTACCGCCAGCGGACTCTGTCAGGAAGATTGTCGAGAAATTGACGGCACAG
GCAAAGAAAGGCCGCGAGAAGGCGGTCATCGCTCTCGGACACCTCTCTATTGGTCTCGAAGCGGCCGAGAAGACT
GAGTTTACTGACACTACCGGGCAAAATGCCGAGACTGGTGCATCTAGGACCGTCCTTGACACCATTCTCGACGAG
CTCTTTTCCCTGTACGACTCGGGGCAGGCCGAGCTTCAGTTCTCCGTTGGAGATGCGATATCCTGCGTCGCTGCC
CGCTGGGACTCAAACACAGTCGCAATAACCATGGACGTCGTTCCTCGAAACGATCGTTACTTTGCTCCGGCAAGA
AGTTCTGTTCTAGAGGCCGTGATTGGTAGACTCCTCCGGGCTTGCATGGACACGAAGCCATCCCTACTCAGGTCG
GCTAGCATCTGGCTGCTCTGTCTCATCATGAACTGTTCGCACCTGGACCCCGTTCAGTCTCGGCTGCGCGAGGTA
CAAGCCGCCTTCATGCGACTGCTGGCCGTGAAGGACGAGGTGGTGCAGGAGACGGCTTCCCGAGGTCTCACTCTC
GTCTACGAGCGTGGTCAAGGCGATCTGAAGGCCTCCTTGGTCAAGGACTTGGTCTCAGCATTCACCGGATCGGGG
ACCCAGCTCAAGGTTGGAGAAGAAACCGAGCTATTCGACCCTGGTGCTCTACCCACAGGAGAAGGCAAGTCTGTC
ACGTCATACAAGGACATTGTAGCCCTGGCCAACGAAGCAGGAGATCAAAGACTGGTATACAAGTTCATGTCTCTC
GCGGCCGACGCGGCAACGTGGTCGACGCGATCGGCTTTTGGGCGGTTCGGGCTCAGCAGCATTCTGTCCGAGGCG
GACATGGACCCCAAGCTATATATGAAGCTCTACAGATACCGATTCGATCCCAATCCCAACGTGCAGAGGTCCATG
GACGCCATCTGGAAGGCCGTGGTCAAGGACCCCAACGCAACACTGGACAAGCACTTTGGAGCCATCATGGAGGAC
CTGCTGAAGAGTCAGCTGGGCCGTGAATGGAGGGTGAGGGAAGCCAGCTGTGCAGCACTATCCAGTTTGATATCA
GGACGGCCGTTTGCGCAATACGAGAAGTACTACAGAGAGGTCTGGAAAACATCGCTCAAGGTACTCGACGACGTC
AAGGGAAGTGTACGCGAGGCGGCGCGGAGGCTCTGCATGAACCTGTCAAACGGCGTTGTGCGGCAGCTCGATGAG
GGCAACCAATCGTCGGTGGCCAAGTCGATGATGCGAGAGGCTTTGCCTTTTCTCTTGTCGGATAAGGGCATGGAG
AGCACGGTGAAGGAGGTACGGATGTTTGCCACGATGACGGTGCTGGGCATCTGCAAGAAAGGAGGCGATGCTTTG
CGCCCCTTTATCCCCGAGACGATGACGCCGCTGCTCGGCCTGCTCAGCACCATCGAGCCCCAGGAGATCAACTAC
CATTACCAGCGAGTGGGAGAGGATGGGCGCGATGAGATTGACAGACTACGGTCACAGATGGTGAACCAGTCGCCC
ATCTCAGAGGCAATCGACGACATGTTGCGCTTCGTCGACGCGGACGTCCTGGCCAAACTGGGGCCTCGTCTCGAA
GACACGATCAAGTCGGCGGTGGGAATGCCGACCAAGATTGGCTGCAGCAGAGTGCTGACGACGCTTGCCACGCGG
CATACGGACCTGTCTCTGTGGGCGAGCCGTTTCCTCAGGCTGCTGCAGAAGCAGGTCCTGGACAAGAACGACGAG
GTGAGCCAGTCATACGCTCGAGCGGCAGCCTACCTCTGGAGAAAGGTTTCGGAAAAGGAGCAGGTGGACTTTTGC
GAGGCCTTTGTGAACAAGTATCTTGCAGCGGAAGACGAGCGTCGGCGCCAGAAGATTGCCGATGTCATCCTGGCC
CTGGCCAAGATTTCGCCCGACGTCTTCACGGCTAACGAAGGCGTCATCTTACCCTTTGTCTACCTCGGCCGCCAC
GACACGGACGAATACACAGCCAAGATGTTTAACGAGGCATGGAGTCAGCACGCGGGGAGCGGCCGAACGGTGATG
CGATATGTCACAGAGATTGTGGCCTTGGTCGAGAAGTGCGTCGACGCGACGCAGTGGTCACTCCGACATACAGCG
GCCTTTACGGTGGCCGCCATGGTCCAAGACGTCGCCAAAGCTACGGATGCAACTGGCGGGATAAGCGAGTCCATG
GCCAGAGAAATGTGGCCGGCGCTGTGCAAGACACTGGCTCTGAAGACGTTTCCCGGCAAGGAGAAGCTGCTGGAA
TCCTTCTGCAAGTTTGTCGAGCAGGGTCGGGCGCTCTGGACCGTCGACGAGGAGGTTGCGATGCTGATGACACAG
ATTGCCGTCCGGGAAGCGAAGCGGAACAATGACGAGTACCGTGTTCATGCCTTTCGCTGTCTGAGGCAGTATTCG
AAAGCACGAGATGATCTGGACATGGCGCAGCAGGTGGAGGCCATAACGAAGCCCTACGAGGACAAGATGGATGTT
GACTGA
Transcript >Ophun1|5466
ATGGCTGCCCCTCCGACTGAGCAGCGGGAGCTGCAGCTGGTCGAGAGCCTCGACTTCAGGATTCTCGGCATCGCC
AACCATGAAGAGAAGCTAAACGAGCTTCTTCAGCGCTTTCTTGCCCCGCTGCTTCTCAAGGCTGCCAGCGAGCAC
TCTTCTGTCCGGACAAAGGTTTTTCAAATACTGGGAAGACTCAAGACCTTCACACGGCCCCCAAGCATCGTTCTG
CCTGTCGAAAAGCTGCTCAAGCAGTACAAGTCGAATCAATCTCCAGTTGTTAAGCAACTGGATCTTTCTTTCGCC
AACCATAGTCTCGACCGATTGGACGCAAAAGATAGGATGGAGCTTATTCCCATCGTTCTAGGAGGACTCGCTGCT
GAAGAGACTCTGCCGAGCGCTGCGAGTATGCTCAATATTGTCCTTCGGCTGCTTCTTGACCTTGAGATACCACCC
CGGGGGAGCAAGGAGGATTCCGCCTTCAGGGAGGCGATTGGTCTCTTGAATAGTGCGGATGCTGAATATCTTGCC
AATGTAATTGGTATATTCTTCCGCTTGCGCACACCAAGGGAATCCCAGGCACTGGCCCTTTCGAATCCCTCTCTC
TCCCAGCAAGAGTTGGCTCTGTTCTCCACCGAAAAGGACGAAAGCGAGAAACTGTTCAAACGATCATCACAGTTG
AAAGCAAAGCTGGTCGCTTTTCTGGCCAGTGGTGCCTTTACAGATGAGGAGAAATTCCTGCCCGCTCTATACGCT
GCGTCCGGTCCCGACAAAAGAGCCGCCTCGGCTGCCGAAGAGATCCTCAAGAGGAGCTCGGTCTCACTGGAAGAC
GACTCACTGATTCAACGGCTTTTTCACGCGCACTCGGTTTCTCCGGCCGCCGGTCGCTCCCGCATACTGGGTATG
CTGAGCAAGTCTACCGTGTCGACGAGGATGTCAGACAGAATAATTGACGTCGTTGAGGTTGATCTCGACACCGAC
GGGTCCGCTGACTCGTGGCAGCGTCCAACCAGCGTTCTGGAGCAAACCCGACTTCATACGGCCTTGTTCCTGTAC
CTATCATGGGTCGCTCGAATCGGACCGTCGGCACCCCCCTTTACTGTTGGCCGGCCGCTCATCAAATACATGCAG
TCCTACATTGAAAAGCAGGGATGGCCTTTACCTCTGGTTGACACCCACGATGCAGTCTATTTGCGGTCCAAGGCC
TACGAAACACTCGGTTCGCTAGCAAGGACCGCCGACCTCACTGTTACCGAGCGACTAGACGTGGGAGATTGGCTT
TTCCAGTCTCTTTCGGAGGATTTCACGAATGACGCAGTGGTCAGCATCGACGGTGCTCTCTCTACCATGTCGGCT
AGTATCCCACCGAGCATTGGGGGCAACAACGCGTCTCTGAAAAGATTGCTGTTGATGCACATGACTCTTCCCGAG
GGAGCCCCTGCGGTCCGAAGCACGCGTCATGCTGCTGTCAAGTGGGCAAACCAATGTCTTCCCTTCTCTGACATC
CTGGGCCGATGGATCGACATTTTGGCAACGGCCGCGCGACCAGACGAACGCAGCGACGTGGTTGAACAGGGCGCC
AAAGGGCTGGATCCTTGGACGAGATCATGGAATGAGGATGCATCGCCTCTGCCCGATTGGAGGGATATGGTGGCA
ACTTTTTGCGACATTGGTGAAGACCCGAATAGCCGGCTACTTAAACGAATCAATGGGACGTCGAATCCTTCTCCT
CCCCCCTACGACAGCTTCTGCACAAAGCGGCGGTCGATTGTTGGCGCTGCGTTGCGATACTGCCGTCTCATCCTG
TTTCTTACGGCTCTCGACGGCTCTGATCAGTATCCGAGCAGCATGCAGGTGCTAGAAAGACAGGTCCGGCAAGAT
ATTCCCACCCGGTCGCGTATTCGAGAATACCTAAAACTCAACGGCTCGTATGTCAACCTCTACCTCAGGTCGTGC
TTGTGGAACGCCAGGAATTCTCCGTCCATCACGGAAGACTGCATGGACTGCTTCACGGATGTGGCTTCCCTCAGT
CCTAGGGAAAGTCTGGAATCCTTGCTTGATGGCGGATTCAGTTCGTTGTTGCTTCAGCTCGTGGAATCCAGGAAC
AAGAAGATCTCGAAGTTGACTGCGAGGGCCGTCGGCATGCTCATCGCTCACCCGGCCTGTCCAGCTGAAGACTTT
GACACCTGGTGTTTCAAACTGCCTCTGTTGATTACCGAAGCAACGCGGCGGCCTGCTGCAGAGATGGACTCTGTC
GAGGGCGGCTTGATGGCTCTCGCGCACCTAAACTCTCGCTCCGTCTATTATGACCGTGAATTTCCGAAGAAAACG
GATTATCCATTTGATCTTTTGGTTGATGAATATTCATCCTCTTCACTCTACGAGACCGCGCTCTATTCCTTTTCA
GAGCTCTGGACGGCAAGACTGGCTCTACCGCCAGCGGACTCTGTCAGGAAGATTGTCGAGAAATTGACGGCACAG
GCAAAGAAAGGCCGCGAGAAGGCGGTCATCGCTCTCGGACACCTCTCTATTGGTCTCGAAGCGGCCGAGAAGACT
GAGTTTACTGACACTACCGGGCAAAATGCCGAGACTGGTGCATCTAGGACCGTCCTTGACACCATTCTCGACGAG
CTCTTTTCCCTGTACGACTCGGGGCAGGCCGAGCTTCAGTTCTCCGTTGGAGATGCGATATCCTGCGTCGCTGCC
CGCTGGGACTCAAACACAGTCGCAATAACCATGGACGTCGTTCCTCGAAACGATCGTTACTTTGCTCCGGCAAGA
AGTTCTGTTCTAGAGGCCGTGATTGGTAGACTCCTCCGGGCTTGCATGGACACGAAGCCATCCCTACTCAGGTCG
GCTAGCATCTGGCTGCTCTGTCTCATCATGAACTGTTCGCACCTGGACCCCGTTCAGTCTCGGCTGCGCGAGGTA
CAAGCCGCCTTCATGCGACTGCTGGCCGTGAAGGACGAGGTGGTGCAGGAGACGGCTTCCCGAGGTCTCACTCTC
GTCTACGAGCGTGGTCAAGGCGATCTGAAGGCCTCCTTGGTCAAGGACTTGGTCTCAGCATTCACCGGATCGGGG
ACCCAGCTCAAGGTTGGAGAAGAAACCGAGCTATTCGACCCTGGTGCTCTACCCACAGGAGAAGGCAAGTCTGTC
ACGTCATACAAGGACATTGTAGCCCTGGCCAACGAAGCAGGAGATCAAAGACTGGTATACAAGTTCATGTCTCTC
GCGGCCGACGCGGCAACGTGGTCGACGCGATCGGCTTTTGGGCGGTTCGGGCTCAGCAGCATTCTGTCCGAGGCG
GACATGGACCCCAAGCTATATATGAAGCTCTACAGATACCGATTCGATCCCAATCCCAACGTGCAGAGGTCCATG
GACGCCATCTGGAAGGCCGTGGTCAAGGACCCCAACGCAACACTGGACAAGCACTTTGGAGCCATCATGGAGGAC
CTGCTGAAGAGTCAGCTGGGCCGTGAATGGAGGGTGAGGGAAGCCAGCTGTGCAGCACTATCCAGTTTGATATCA
GGACGGCCGTTTGCGCAATACGAGAAGTACTACAGAGAGGTCTGGAAAACATCGCTCAAGGTACTCGACGACGTC
AAGGGAAGTGTACGCGAGGCGGCGCGGAGGCTCTGCATGAACCTGTCAAACGGCGTTGTGCGGCAGCTCGATGAG
GGCAACCAATCGTCGGTGGCCAAGTCGATGATGCGAGAGGCTTTGCCTTTTCTCTTGTCGGATAAGGGCATGGAG
AGCACGGTGAAGGAGGTACGGATGTTTGCCACGATGACGGTGCTGGGCATCTGCAAGAAAGGAGGCGATGCTTTG
CGCCCCTTTATCCCCGAGACGATGACGCCGCTGCTCGGCCTGCTCAGCACCATCGAGCCCCAGGAGATCAACTAC
CATTACCAGCGAGTGGGAGAGGATGGGCGCGATGAGATTGACAGACTACGGTCACAGATGGTGAACCAGTCGCCC
ATCTCAGAGGCAATCGACGACATGTTGCGCTTCGTCGACGCGGACGTCCTGGCCAAACTGGGGCCTCGTCTCGAA
GACACGATCAAGTCGGCGGTGGGAATGCCGACCAAGATTGGCTGCAGCAGAGTGCTGACGACGCTTGCCACGCGG
CATACGGACCTGTCTCTGTGGGCGAGCCGTTTCCTCAGGCTGCTGCAGAAGCAGGTCCTGGACAAGAACGACGAG
GTGAGCCAGTCATACGCTCGAGCGGCAGCCTACCTCTGGAGAAAGGTTTCGGAAAAGGAGCAGGTGGACTTTTGC
GAGGCCTTTGTGAACAAGTATCTTGCAGCGGAAGACGAGCGTCGGCGCCAGAAGATTGCCGATGTCATCCTGGCC
CTGGCCAAGATTTCGCCCGACGTCTTCACGGCTAACGAAGGCGTCATCTTACCCTTTGTCTACCTCGGCCGCCAC
GACACGGACGAATACACAGCCAAGATGTTTAACGAGGCATGGAGTCAGCACGCGGGGAGCGGCCGAACGGTGATG
CGATATGTCACAGAGATTGTGGCCTTGGTCGAGAAGTGCGTCGACGCGACGCAGTGGTCACTCCGACATACAGCG
GCCTTTACGGTGGCCGCCATGGTCCAAGACGTCGCCAAAGCTACGGATGCAACTGGCGGGATAAGCGAGTCCATG
GCCAGAGAAATGTGGCCGGCGCTGTGCAAGACACTGGCTCTGAAGACGTTTCCCGGCAAGGAGAAGCTGCTGGAA
TCCTTCTGCAAGTTTGTCGAGCAGGGTCGGGCGCTCTGGACCGTCGACGAGGAGGTTGCGATGCTGATGACACAG
ATTGCCGTCCGGGAAGCGAAGCGGAACAATGACGAGTACCGTGTTCATGCCTTTCGCTGTCTGAGGCAGTATTCG
AAAGCACGAGATGATCTGGACATGGCGCAGCAGGTGGAGGCCATAACGAAGCCCTACGAGGACAAGATGGATGTT
GACTGA
Gene >Ophun1|5466
ATGGCTGCCCCTCCGACTGAGCAGCGGGAGCTGCAGCTGGTCGAGAGCCTCGACTTCAGGATTCTCGGCATCGCC
AACCATGAAGAGAAGCTAAACGAGCTTCTTCAGCGCTTTCTTGCCCCGCTGCTTCTCAAGGCTGCCAGCGAGCAC
TCTTCTGTCCGGACAAAGGTGCGTCGAAGCCGGCAGTTCACTCGCTTTCCGGAGAGTGCCATTGTCCTCGCGGAT
GATGATGAGAAAGGCCGCTTGACGCTGTCTTTCGTGAACCCAGGCTGACAATTCTTGAACAGGTTTTTCAAATAC
TGGGAAGACTCAAGACCTTCACACGGCCCCCAAGCATCGTTCTGCCTGTCGAAAAGCTGCTCAAGCAGTACAAGT
CGAATCAATCTCCAGTTGTTAAGCAACTGGATCTTTCTTTCGCCAACCATAGTCTCGACCGATTGGACGCAAAAG
ATAGGATGGAGCTTATTCCCATCGTTCTAGGAGGACTCGCTGCTGAAGAGACTCTGCCGAGCGCTGCGAGTATGC
TCAATATTGTCCTTCGGCTGCTTCTTGACCTTGAGATACCACCCCGGGGGAGCAAGGAGGATTCCGCCTTCAGGG
AGGCGATTGGTCTCTTGAATAGTGCGGATGCTGAATATCTTGCCAATGTAATTGGTATATTCTTCCGCTTGCGCA
CACCAAGGGAATCCCAGGCACTGGCCCTTTCGAATCCCTCTCTCTCCCAGCAAGAGTTGGCTCTGTTCTCCACCG
AAAAGGACGAAAGCGAGAAACTGTTCAAACGATCATCACAGTTGAAAGCAAAGCTGGTCGCTTTTCTGGCCAGTG
GTGCCTTTACAGATGAGGAGAAATTCCTGCCCGCTCTATACGCTGCGTCCGGTCCCGACAAAAGAGCCGCCTCGG
CTGCCGAAGAGATCCTCAAGAGGAGCTCGGTCTCACTGGAAGACGACTCACTGATTCAACGGCTTTTTCACGCGC
ACTCGGTTTCTCCGGCCGCCGGTCGCTCCCGCATACTGGGTATGCTGAGCAAGTCTACCGTGTCGACGAGGATGT
CAGACAGAATAATTGACGTCGTTGAGGTTGATCTCGACACCGACGGGTCCGCTGACTCGTGGCAGCGTCCAACCA
GCGTTCTGGAGCAAACCCGACTTCATACGGCCTTGTTCCTGTACCTATCATGGGTCGCTCGAATCGGACCGTCGG
CACCCCCCTTTACTGTTGGCCGGCCGCTCATCAAATACATGCAGTCCTACATTGAAAAGCAGGGATGGCCTTTAC
CTCTGGTTGACACCCACGATGCAGTCTATTTGCGGTCCAAGGCCTACGAAACACTCGGTTCGCTAGCAAGGACCG
CCGACCTCACTGTTACCGAGCGACTAGACGTGGGAGATTGGCTTTTCCAGTCTCTTTCGGAGGATTTCACGAATG
ACGCAGTGGTCAGCATCGACGGTGCTCTCTCTACCATGTCGGCTAGTATCCCACCGAGCATTGGGGGCAACAACG
CGTCTCTGAAAAGATTGCTGTTGATGCACATGACTCTTCCCGAGGGAGCCCCTGCGGTCCGAAGCACGCGTCATG
CTGCTGTCAAGTGGGCAAACCAATGTCTTCCCTTCTCTGACATCCTGGGCCGATGGATCGACATTTTGGCAACGG
CCGCGCGACCAGACGAACGCAGCGACGTGGTTGAACAGGGCGCCAAAGGGCTGGATCCTTGGACGAGATCATGGA
ATGAGGATGCATCGCCTCTGCCCGATTGGAGGGATATGGTGGCAACTTTTTGCGACATTGGTGAAGACCCGAATA
GCCGGCTACTTAAACGAATCAATGGGACGTCGAATCCTTCTCCTCCCCCCTACGACAGCTTCTGCACAAAGCGGC
GGTCGATTGTTGGCGCTGCGTTGCGATACTGCCGTCTCATCCTGTTTCTTACGGCTCTCGACGGCTCTGATCAGT
ATCCGAGCAGCATGCAGGTGCTAGAAAGACAGGTCCGGCAAGATATTCCCACCCGGTCGCGTATTCGAGAATACC
TAAAACTCAACGGCTCGTATGTCAACCTCTACCTCAGGTCGTGCTTGTGGAACGCCAGGAATTCTCCGTCCATCA
CGGAAGACTGCATGGACTGCTTCACGGATGTGGCTTCCCTCAGTCCTAGGGAAAGTCTGGAATCCTTGCTTGATG
GCGGATTCAGTTCGTTGTTGCTTCAGCTCGTGGAATCCAGGAACAAGAAGATCTCGAAGTTGACTGCGAGGGCCG
TCGGCATGCTCATCGCTCACCCGGCCTGTCCAGCTGAAGACTTTGACACCTGGTGTTTCAAACTGCCTCTGTTGA
TTACCGAAGCAACGCGGCGGCCTGCTGCAGAGATGGACTCTGTCGAGGGCGGCTTGATGGCTCTCGCGCACCTAA
ACTCTCGCTCCGTCTATTATGACCGTGAATTTCCGAAGAAAACGGATTATCCATTTGATCTTTTGGTTGATGAAT
ATTCATCCTCTTCACTCTACGAGACCGCGCTCTATTCCTTTTCAGAGCTCTGGACGGCAAGACTGGCTCTACCGC
CAGCGGACTCTGTCAGGAAGATTGTCGAGAAATTGACGGCACAGGCAAAGAAAGGCCGCGAGAAGGCGGTCATCG
CTCTCGGACACCTCTCTATTGGTCTCGAAGCGGCCGAGAAGACTGAGTTTACTGACACTACCGGGCAAAATGCCG
AGACTGGTGCATCTAGGACCGTCCTTGACACCATTCTCGACGAGCTCTTTTCCCTGTACGACTCGGGGCAGGCCG
AGCTTCAGTTCTCCGTTGGAGATGCGATATCCTGCGTCGCTGCCCGCTGGGACTCAAACACAGTCGCAATAACCA
TGGACGTCGTTCCTCGAAACGATCGTTACTTTGCTCCGGCAAGAAGTTCTGTTCTAGAGGCCGTGATTGGTAGAC
TCCTCCGGGCTTGCATGGACACGAAGCCATCCCTACTCAGGTCGGCTAGCATCTGGCTGCTCTGTCTCATCATGA
ACTGTTCGCACCTGGACCCCGTTCAGTCTCGGCTGCGCGAGGTACAAGCCGCCTTCATGCGACTGCTGGCCGTGA
AGGACGAGGTGGTGCAGGAGACGGCTTCCCGAGGTCTCACTCTCGTCTACGAGCGTGGTCAAGGCGATCTGAAGG
CCTCCTTGGTCAAGGACTTGGTCTCAGCATTCACCGGATCGGGGACCCAGCTCAAGGTTGGAGAAGAAACCGAGC
TATTCGACCCTGGTGCTCTACCCACAGGAGAAGGCAAGTCTGTCACGTCATACAAGGACATTGTAGCCCTGGCCA
ACGAAGCAGGAGATCAAAGACTGGTATACAAGTTCATGTCTCTCGCGGCCGACGCGGCAACGTGGTCGACGCGAT
CGGCTTTTGGGCGGTTCGGGCTCAGCAGCATTCTGTCCGAGGCGGACATGGACCCCAAGCTATATATGAAGCTCT
ACAGATACCGATTCGATCCCAATCCCAACGTGCAGAGGTCCATGGACGCCATCTGGAAGGCCGTGGTCAAGGACC
CCAACGCAACACTGGACAAGCACTTTGGAGCCATCATGGAGGACCTGCTGAAGAGTCAGCTGGGCCGTGAATGGA
GGGTGAGGGAAGCCAGCTGTGCAGCACTATCCAGTTTGATATCAGGACGGCCGTTTGCGCAATACGAGAAGTACT
ACAGAGAGGTCTGGAAAACATCGCTCAAGGTACTCGACGACGTCAAGGGAAGTGTACGCGAGGCGGCGCGGAGGC
TCTGCATGAACCTGTCAAACGGCGTTGTGCGGCAGCTCGATGAGGGCAACCAATCGTCGGTGGCCAAGTCGATGA
TGCGAGAGGCTTTGCCTTTTCTCTTGTCGGATAAGGGCATGGAGAGCACGGTGAAGGAGGTACGGATGTTTGCCA
CGATGACGGTGCTGGGCATCTGCAAGAAAGGAGGCGATGCTTTGCGCCCCTTTATCCCCGAGACGATGACGCCGC
TGCTCGGCCTGCTCAGCACCATCGAGCCCCAGGAGATCAACTACCATTACCAGCGAGTGGGAGAGGATGGGCGCG
ATGAGATTGACAGACTACGGTCACAGATGGTGAACCAGTCGCCCATCTCAGAGGCAATCGACGACATGTTGCGCT
TCGTCGACGCGGACGTCCTGGCCAAACTGGGGCCTCGTCTCGAAGACACGATCAAGTCGGCGGTGGGAATGCCGA
CCAAGATTGGCTGCAGCAGAGTGCTGACGACGCTTGCCACGCGGCATACGGACCTGTCTCTGTGGGCGAGCCGTT
TCCTCAGGCTGCTGCAGAAGCAGGTCCTGGACAAGAACGACGAGGTGAGCCAGTCATACGCTCGAGCGGCAGCCT
ACCTCTGGAGAAAGGTTTCGGAAAAGGAGCAGGTGGACTTTTGCGAGGCCTTTGTGAACAAGTATCTTGCAGCGG
AAGACGAGCGTCGGCGCCAGAAGATTGCCGATGTCATCCTGGCCCTGGCCAAGATTTCGCCCGACGTCTTCACGG
CTAACGAAGGCGTCATCTTACCCTTTGTCTACCTCGGCCGCCACGACACGGACGAATACACAGCCAAGATGTTTA
ACGAGGCATGGAGTCAGCACGCGGGGAGCGGCCGAACGGTGATGCGATATGTCACAGAGATTGTGGCCTTGGTCG
AGAAGTGCGTCGACGCGACGCAGTGGTCACTCCGACATACAGCGGCCTTTACGGTGGCCGCCATGGTCCAAGACG
TCGCCAAAGCTACGGATGCAACTGGCGGGATAAGCGAGTCCATGGCCAGAGAAATGTGGCCGGCGCTGTGCAAGA
CACTGGCTCTGAAGACGTTTCCCGGCAAGGAGAAGCTGCTGGAATCCTTCTGCAAGTTTGTCGAGCAGGGTCGGG
CGCTCTGGACCGTCGACGAGGAGGTTGCGATGCTGATGACACAGATTGCCGTCCGGGAAGCGAAGCGGAACAATG
ACGAGTACCGTGTTCATGCCTTTCGCTGTCTGAGGCAGTATTCGAAAGCACGAGATGATCTGGACATGGCGCAGC
AGGTGGAGGCCATAACGAAGCCCTACGAGGACAAGATGGATGTTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail