Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5465
Gene name
LocationContig_540:572..2241
Strand-
Gene length (bp)1669
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13899 Thioredoxin_7 Thioredoxin-like 4.9E-14 231 317
PF14555 UBA_4 UBA-like domain 2.1E-11 2 42
PF00789 UBX UBX domain 1.1E-05 458 534

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 211 535 1.0E-47
sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 210 534 4.0E-45
sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 142 388 5.0E-32
sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 142 388 3.0E-31
sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 142 388 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14048|UBX2_SCHPO UBX domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubx2 PE=1 SV=1 211 535 1.0E-47
sp|Q06682|UBX5_YEAST UBX domain-containing protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX5 PE=1 SV=1 210 534 4.0E-45
sp|Q6P5G6|UBXN7_MOUSE UBX domain-containing protein 7 OS=Mus musculus GN=Ubxn7 PE=1 SV=2 142 388 5.0E-32
sp|Q5REY7|UBXN7_PONAB UBX domain-containing protein 7 OS=Pongo abelii GN=UBXN7 PE=2 SV=2 142 388 3.0E-31
sp|O94888|UBXN7_HUMAN UBX domain-containing protein 7 OS=Homo sapiens GN=UBXN7 PE=1 SV=2 142 388 3.0E-31
sp|Q55BU7|UBXN7_DICDI UBX domain-containing protein 7 homolog OS=Dictyostelium discoideum GN=ubxd7 PE=3 SV=1 213 402 3.0E-24
sp|Q94JZ8|PUX7_ARATH Plant UBX domain-containing protein 7 OS=Arabidopsis thaliana GN=PUX7 PE=1 SV=1 131 388 3.0E-21
sp|P0DKI4|PUX14_ARATH Putative plant UBX domain-containing protein 14 OS=Arabidopsis thaliana GN=PUX14 PE=5 SV=1 197 535 2.0E-17
sp|P0DKI5|PUX16_ARATH Plant UBX domain-containing protein 16 OS=Arabidopsis thaliana GN=PUX16 PE=2 SV=1 219 535 3.0E-10
sp|Q94HV8|PUX15_ARATH Putative plant UBX domain-containing protein 15 OS=Arabidopsis thaliana GN=PUX15 PE=5 SV=2 231 361 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5465
MDETISTFVSITGASADVARGFVQLAGGDFERAVGLYFENPDLVSGVGADVSANDPPPLPTSERPSLGRQDSAGV
IHISDDEADQDLMHLDEGDDEDDGGLAAAAGSSRAAALLQEEEDAAMAKRLQEELYGGGQGSGAGDEDGVRAPIA
RTTETLIAPDPAWGGGPEDDLNVAFLEEMRRRRPLPPRSGGPFGQGIWGDGGSSSAENGSHARRLEDLFRPPYDL
MTRAPWDEARTLGKSLKKWLLVNLQDMNDFNCQALNRDIWKDQAVQDLVEENFIFMQYDKDYPDAEEYVTFYLPH
RSYENPDMFPHVSIVDPRTGEQVKVWSGRPFPSASEFHAELAEFLDRYSLAANSKNPVAKATTRRRQPVDVDRMT
EDEMLEMALKNSLAGAGEGGDEAGTGSATSNNLDDPDALTKSPGPSGTEASEDKGKGIETTETCPFDLISDSQPH
TEPEADAATTTRIQFKHPDGRVIRRFRLQDPVRRIYEWLKAEPLADKQGVKFELKRMPQGQDLLECLEGTVEETG
LKQGTVMVEFVED*
Coding >Ophun1|5465
ATGGACGAGACCATCTCCACCTTCGTCTCCATCACGGGGGCGAGCGCAGACGTGGCACGGGGCTTCGTGCAGCTG
GCGGGCGGCGACTTTGAGCGCGCAGTCGGCCTGTATTTCGAGAACCCTGATCTCGTGTCCGGCGTGGGAGCCGAT
GTCTCGGCCAACGATCCGCCTCCGCTGCCGACTTCTGAGAGGCCCAGTCTCGGCCGGCAAGACTCTGCCGGCGTG
ATCCACATCAGCGATGACGAAGCCGATCAAGATCTGATGCACCTGGACGAGGGCGACGACGAAGATGACGGCGGC
TTGGCTGCTGCTGCCGGCTCCAGCAGAGCTGCGGCTCTTCTCCAGGAAGAGGAAGATGCGGCCATGGCGAAGCGG
TTGCAGGAGGAGCTCTACGGGGGTGGTCAGGGCTCTGGCGCGGGCGATGAAGACGGCGTCAGAGCTCCTATCGCG
AGAACTACGGAGACGCTCATTGCGCCCGACCCGGCTTGGGGCGGCGGACCCGAAGATGATCTGAACGTCGCGTTT
CTGGAAGAGATGAGAAGGCGTCGGCCACTACCACCTCGAAGCGGCGGACCGTTTGGCCAGGGCATCTGGGGAGAT
GGCGGCTCATCGTCGGCGGAAAACGGCAGCCACGCGCGGAGACTGGAGGATCTGTTTCGACCGCCGTACGATCTG
ATGACGCGCGCGCCGTGGGACGAGGCTCGGACCCTGGGCAAGAGTCTCAAGAAGTGGCTGCTCGTCAACCTACAG
GATATGAACGACTTCAACTGTCAAGCGCTCAACCGCGACATATGGAAGGATCAGGCGGTACAGGACCTGGTGGAG
GAGAACTTCATCTTTATGCAGTACGACAAGGACTACCCGGACGCAGAAGAGTACGTCACGTTCTACCTGCCGCAC
CGAAGCTACGAGAACCCGGACATGTTCCCGCACGTGTCCATCGTCGACCCGCGGACGGGCGAGCAGGTCAAGGTC
TGGAGCGGGCGGCCATTCCCCAGCGCGAGCGAGTTCCACGCGGAGCTAGCCGAGTTCCTGGACCGGTACAGCCTG
GCGGCCAACAGCAAGAACCCGGTGGCCAAGGCGACGACGCGGAGACGGCAGCCGGTCGACGTCGACCGGATGACG
GAGGACGAGATGCTGGAGATGGCGCTCAAGAACAGCCTGGCGGGCGCCGGCGAAGGAGGCGATGAGGCGGGGACG
GGCTCGGCTACCAGTAATAACCTGGACGATCCGGACGCGTTGACCAAGAGTCCTGGCCCGAGCGGAACAGAGGCT
TCGGAAGACAAGGGGAAAGGCATCGAAACTACCGAGACTTGTCCCTTTGACCTCATCTCCGACTCGCAGCCTCAC
ACGGAACCAGAGGCAGATGCAGCGACGACGACACGGATCCAGTTCAAGCACCCAGACGGCAGGGTAATCCGACGC
TTCCGACTACAAGACCCGGTACGACGAATCTACGAGTGGCTCAAGGCCGAGCCACTGGCCGACAAGCAGGGCGTC
AAGTTCGAACTGAAGCGGATGCCGCAGGGACAGGACCTGCTGGAATGCCTGGAGGGCACGGTGGAGGAGACGGGG
CTGAAGCAGGGGACGGTAATGGTTGAATTTGTGGAGGACTGA
Transcript >Ophun1|5465
ATGGACGAGACCATCTCCACCTTCGTCTCCATCACGGGGGCGAGCGCAGACGTGGCACGGGGCTTCGTGCAGCTG
GCGGGCGGCGACTTTGAGCGCGCAGTCGGCCTGTATTTCGAGAACCCTGATCTCGTGTCCGGCGTGGGAGCCGAT
GTCTCGGCCAACGATCCGCCTCCGCTGCCGACTTCTGAGAGGCCCAGTCTCGGCCGGCAAGACTCTGCCGGCGTG
ATCCACATCAGCGATGACGAAGCCGATCAAGATCTGATGCACCTGGACGAGGGCGACGACGAAGATGACGGCGGC
TTGGCTGCTGCTGCCGGCTCCAGCAGAGCTGCGGCTCTTCTCCAGGAAGAGGAAGATGCGGCCATGGCGAAGCGG
TTGCAGGAGGAGCTCTACGGGGGTGGTCAGGGCTCTGGCGCGGGCGATGAAGACGGCGTCAGAGCTCCTATCGCG
AGAACTACGGAGACGCTCATTGCGCCCGACCCGGCTTGGGGCGGCGGACCCGAAGATGATCTGAACGTCGCGTTT
CTGGAAGAGATGAGAAGGCGTCGGCCACTACCACCTCGAAGCGGCGGACCGTTTGGCCAGGGCATCTGGGGAGAT
GGCGGCTCATCGTCGGCGGAAAACGGCAGCCACGCGCGGAGACTGGAGGATCTGTTTCGACCGCCGTACGATCTG
ATGACGCGCGCGCCGTGGGACGAGGCTCGGACCCTGGGCAAGAGTCTCAAGAAGTGGCTGCTCGTCAACCTACAG
GATATGAACGACTTCAACTGTCAAGCGCTCAACCGCGACATATGGAAGGATCAGGCGGTACAGGACCTGGTGGAG
GAGAACTTCATCTTTATGCAGTACGACAAGGACTACCCGGACGCAGAAGAGTACGTCACGTTCTACCTGCCGCAC
CGAAGCTACGAGAACCCGGACATGTTCCCGCACGTGTCCATCGTCGACCCGCGGACGGGCGAGCAGGTCAAGGTC
TGGAGCGGGCGGCCATTCCCCAGCGCGAGCGAGTTCCACGCGGAGCTAGCCGAGTTCCTGGACCGGTACAGCCTG
GCGGCCAACAGCAAGAACCCGGTGGCCAAGGCGACGACGCGGAGACGGCAGCCGGTCGACGTCGACCGGATGACG
GAGGACGAGATGCTGGAGATGGCGCTCAAGAACAGCCTGGCGGGCGCCGGCGAAGGAGGCGATGAGGCGGGGACG
GGCTCGGCTACCAGTAATAACCTGGACGATCCGGACGCGTTGACCAAGAGTCCTGGCCCGAGCGGAACAGAGGCT
TCGGAAGACAAGGGGAAAGGCATCGAAACTACCGAGACTTGTCCCTTTGACCTCATCTCCGACTCGCAGCCTCAC
ACGGAACCAGAGGCAGATGCAGCGACGACGACACGGATCCAGTTCAAGCACCCAGACGGCAGGGTAATCCGACGC
TTCCGACTACAAGACCCGGTACGACGAATCTACGAGTGGCTCAAGGCCGAGCCACTGGCCGACAAGCAGGGCGTC
AAGTTCGAACTGAAGCGGATGCCGCAGGGACAGGACCTGCTGGAATGCCTGGAGGGCACGGTGGAGGAGACGGGG
CTGAAGCAGGGGACGGTAATGGTTGAATTTGTGGAGGACTGA
Gene >Ophun1|5465
ATGGACGAGACCATCTCCACCTTCGTCTCCATCACGGGGGCGAGCGCAGACGTGGCACGGGGCTTCGTGCAGCTG
GCGGGCGGCGACTTTGAGCGCGCAGTCGGCCTGTATTTCGAGAACCCTGATCTCGTGTCCGGCGTGGGAGCCGAT
GTCTCGGCCAACGATCCGCCTCCGCTGCCGACTTCTGAGAGGCCCAGTCTCGGCCGGCAAGACTCTGCCGGCGTG
ATCCACATCAGCGATGACGAAGCCGATCAAGATCTGATGCACCTGGACGAGGGCGACGACGAAGATGACGGCGGC
TTGGCTGCTGCTGCCGGCTCCAGCAGAGCTGCGGCTCTTCTCCAGGAAGAGGAAGATGCGGCCATGGCGAAGCGG
TTGCAGGAGGAGCTCTACGGGGGTGGTCAGGGCTCTGGCGCGGGCGATGAAGACGGCGTCAGAGCTCCTATCGCG
AGAACTACGGAGACGCTCATTGCGCCCGACCCGGCTTGGGGCGGCGGACCCGAAGATGATCTGAACGTCGCGTTT
CTGGAAGAGATGAGAAGGCGTCGGCCACTACCACGTGAGATTTCTTCTATCAACATCATCCACTCCTACTGACAG
TACTTGATCAGCTCGAAGCGGCGGACCGTTTGGCCAGGGCATCTGGGGAGATGGCGGCTCATCGTCGGCGGAAAA
CGGCAGCCACGCGCGGAGACTGGAGGATCTGTTTCGACCGCCGTACGATCTGATGACGCGCGCGCCGTGGGACGA
GGCTCGGACCCTGGGCAAGAGTCTCAAGAAGTGGCTGCTCGTCAACCTACAGGATATGAACGACTTCAACTGTCA
AGCGCTCAACCGCGACATATGGAAGGATCAGGCGGTACAGGACCTGGTGGAGGAGAACTTCATCTTTATGCAGTA
CGACAAGGACTACCCGGACGCAGAAGAGTACGTCACGTTCTACCTGCCGCACCGAAGCTACGAGAACCCGGACAT
GTTCCCGCACGTGTCCATCGTCGACCCGCGGACGGGCGAGCAGGTCAAGGTCTGGAGCGGGCGGCCATTCCCCAG
CGCGAGCGAGTTCCACGCGGAGCTAGCCGAGTTCCTGGACCGGTACAGCCTGGCGGCCAACAGCAAGAACCCGGT
GGCCAAGGCGACGACGCGGAGACGGCAGCCGGTCGACGTCGACCGGATGACGGAGGACGAGATGCTGGAGATGGC
GCTCAAGAACAGCCTGGCGGGCGCCGGCGAAGGAGGCGATGAGGCGGGGACGGGCTCGGCTACCAGTAATAACCT
GGACGATCCGGACGCGTTGACCAAGAGTCCTGGCCCGAGCGGAACAGAGGCTTCGGAAGACAAGGGGAAAGGCAT
CGAAACTACCGAGACTTGTCCCTTTGACCTCATCTCCGACTCGCAGCCTCACACGGAACCAGAGGCAGATGCAGC
GACGACGACACGGATCCAGTTCAAGCACCCAGACGGCAGGGTAATCCGACGCTTCCGACTACAAGACCCGGTACG
ACGAATCTACGAGTGGCTCAAGGCCGAGCCACTGGCCGACAAGCAGGGCGTCAAGTTCGAACTGAAGCGGATGCC
GCAGGGACAGGACCTGCTGGAATGCCTGGAGGGCACGGTGGAGGAGACGGGGCTGAAGCAGGGGACGGTAATGGT
TGAATTTGTGGAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail