Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5461
Gene name
LocationContig_54:38194..40693
Strand-
Gene length (bp)2499
Transcript length (bp)2499
Coding sequence length (bp)2499
Protein length (aa) 833

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily 5.1E-28 378 572
PF00857 Isochorismatase Isochorismatase family 3.5E-25 17 195
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 2.4E-07 759 818

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P6J4|ALKB2_MOUSE DNA oxidative demethylase ALKBH2 OS=Mus musculus GN=Alkbh2 PE=1 SV=1 443 574 6.0E-14
sp|Q6NS38|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 OS=Homo sapiens GN=ALKBH2 PE=1 SV=1 443 574 7.0E-14
sp|Q58DM4|ALKB2_BOVIN DNA oxidative demethylase ALKBH2 OS=Bos taurus GN=ALKBH2 PE=2 SV=1 443 574 5.0E-13
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 392 597 1.0E-10
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 392 586 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6P6J4|ALKB2_MOUSE DNA oxidative demethylase ALKBH2 OS=Mus musculus GN=Alkbh2 PE=1 SV=1 443 574 6.0E-14
sp|Q6NS38|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 OS=Homo sapiens GN=ALKBH2 PE=1 SV=1 443 574 7.0E-14
sp|Q58DM4|ALKB2_BOVIN DNA oxidative demethylase ALKBH2 OS=Bos taurus GN=ALKBH2 PE=2 SV=1 443 574 5.0E-13
sp|Q5XIC8|ALKB3_RAT Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Rattus norvegicus GN=Alkbh3 PE=2 SV=1 392 597 1.0E-10
sp|Q32L00|ALKB3_BOVIN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Bos taurus GN=ALKBH3 PE=2 SV=1 392 586 4.0E-10
sp|Q8K1E6|ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus GN=Alkbh3 PE=1 SV=1 411 580 2.0E-09
sp|Q96Q83|ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens GN=ALKBH3 PE=1 SV=1 413 586 2.0E-09
sp|Q9SIE0|ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana GN=ALKBH2 PE=2 SV=2 460 574 1.0E-06
sp|O32091|PNCA_BACSU Uncharacterized isochorismatase family protein PncA OS=Bacillus subtilis (strain 168) GN=pncA PE=3 SV=1 15 202 1.0E-06
sp|Q5UQK2|YR406_MIMIV Uncharacterized protein R406 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R406 PE=3 SV=1 380 575 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5461
MFPFDTAALPQLTTRKALIAVDLQNDFVGLDGEATLPVREPEGFVARVVALSEAFRAVGDVVWVQSRFDEPRPEP
GPEESPAGDPEAFLSDEAFDCVRADSSGAEMAPMVQAAVRPRDAVLTKTHYSAFQETALLRVLRAHMVMEVFLCG
SLTNVGVYATAIDAACHGMAITLVEDCCGYRSNGRRARAVKSLVELTGCDVASSKEVLLLIRPKQPVLPSKQNED
KPPTSIDLVKSMKGLSIVSDSPRDGADKSKSTSKTTLKSSSLASSPTGSSNPSAAAAHGNGADDGGDDDDDDDDD
DDDDDDDDDDDDGDGDDDNDNDDDRCRASPKDTTTSVKLDARQRTPTPLASTPSTVSSTATTATKDDDCPPLCEG
DTHVILNALPSSLEHDIFSRLRNEVDWQPMSHQGSPVPRLVAVQGTISTDGSVPVYRHPADESPALLPFSKTVLA
VKDQVEHHVGHPVNHVLIQLYRDGNDYISEHSDKTLDIVPGSFIANVSLGAQRTMVLRTKRRAPGESRQVQRATL
PHNSLCRMGLRTNMKWLHAIRQDRRADRDKTPDELAFDGARISLTFRRIGTFLDPERGLIWGQGARGKTRADARP
VINGQGPEAVAMLRAFGAENHGSVVDWDALYGDGFDQLHIHAAPRLFASADDTVINMQLSLMLAELGVSHAKGTM
AATTTAINDPPVKFIDNDAARTEVTGHEAIMLYLDSFYGGGQTSPRNELALRYTHFQRATRLLHLSRSPPNQDAA
APPKPLSSELDAWNTILERAPSRPFLAGAAPSLPDFALWPVLHAVVERCGGGDVVLGRLEGLRRYYDAVAARESV
RGILERR*
Coding >Ophun1|5461
ATGTTTCCCTTCGACACGGCCGCCCTGCCCCAGCTGACGACCCGCAAGGCCCTGATCGCCGTCGACTTGCAAAAT
GACTTTGTTGGACTCGACGGTGAAGCGACGCTGCCTGTTCGTGAACCGGAAGGCTTCGTCGCCCGCGTCGTGGCC
TTGTCCGAGGCCTTTCGTGCCGTGGGTGACGTCGTCTGGGTCCAGTCGCGCTTCGACGAACCACGGCCGGAGCCA
GGTCCGGAGGAGAGCCCGGCCGGCGATCCGGAGGCATTCCTCAGCGACGAGGCCTTTGATTGCGTCAGAGCCGAC
TCTTCAGGGGCCGAGATGGCGCCAATGGTCCAGGCCGCCGTCCGACCCCGTGACGCCGTCCTCACCAAGACGCAT
TACTCGGCCTTTCAGGAAACGGCCCTGCTGCGCGTCCTGCGCGCCCACATGGTCATGGAGGTCTTTCTCTGCGGT
TCCCTGACCAACGTGGGCGTCTATGCCACCGCCATCGACGCAGCCTGCCACGGCATGGCCATCACCCTCGTCGAG
GACTGCTGCGGCTACCGAAGCAACGGGCGTAGGGCCAGGGCTGTAAAGAGCCTCGTCGAGCTCACGGGCTGTGAT
GTTGCCAGTAGCAAAGAGGTCTTGCTCCTGATTCGGCCCAAGCAGCCAGTGTTGCCATCGAAGCAGAACGAGGAT
AAGCCACCGACGTCGATCGACCTGGTTAAGTCCATGAAGGGACTAAGCATCGTCAGCGACTCGCCGCGAGACGGA
GCTGATAAATCGAAGTCGACTTCAAAGACAACATTGAAATCGTCTTCTCTTGCCTCTTCCCCTACTGGTTCGTCT
AACCCTTCAGCGGCTGCGGCTCACGGCAATGGAGCCGATGATGGTGGTGATGATGACGATGACGATGACGATGAC
GATGACGATGACGATGACGACGACGATGACGATGACGGCGACGGCGACGACGACAATGACAATGACGATGACCGT
TGCAGGGCATCTCCCAAGGACACAACAACCTCAGTCAAGCTTGACGCTCGGCAAAGAACTCCAACTCCACTGGCA
TCCACGCCTTCTACAGTCTCGTCAACCGCAACAACGGCAACGAAAGACGACGACTGCCCACCCCTCTGCGAAGGC
GACACGCACGTCATTCTCAACGCCCTCCCCTCCTCGCTCGAGCACGACATCTTCTCCCGGCTCCGGAACGAGGTC
GACTGGCAGCCCATGAGCCACCAGGGAAGCCCTGTTCCCCGGCTCGTGGCTGTCCAGGGCACCATCTCGACCGAC
GGATCCGTGCCCGTCTACCGGCACCCGGCCGACGAGTCTCCAGCTCTCCTGCCCTTTTCGAAGACGGTGCTGGCC
GTCAAGGATCAGGTCGAGCATCACGTCGGCCACCCAGTCAACCACGTTCTCATCCAGCTATACCGCGACGGCAAT
GACTACATCTCGGAACACAGCGATAAGACGCTCGACATCGTGCCCGGCTCCTTCATCGCAAACGTCAGCCTCGGC
GCCCAACGGACCATGGTGCTGCGAACCAAGAGACGCGCCCCCGGTGAGAGCCGTCAAGTTCAGCGGGCAACGCTG
CCTCACAACTCGCTGTGTCGCATGGGCCTGCGCACCAACATGAAATGGCTCCACGCCATCCGTCAGGACCGTCGC
GCCGACCGCGATAAGACGCCGGACGAGCTGGCCTTTGACGGTGCCCGTATCTCACTCACCTTCCGCCGTATCGGC
ACCTTTCTCGACCCGGAGCGAGGCCTCATCTGGGGCCAGGGCGCCAGGGGTAAGACGCGCGCCGATGCTCGACCC
GTCATCAACGGTCAGGGCCCCGAGGCTGTCGCCATGCTTCGCGCTTTTGGAGCAGAGAACCACGGGTCAGTGGTC
GACTGGGATGCTCTCTACGGCGACGGCTTCGACCAACTGCACATCCACGCCGCGCCTCGTCTCTTCGCCTCGGCC
GACGACACCGTCATCAACATGCAACTCTCTCTCATGCTAGCTGAGCTCGGCGTCTCCCATGCCAAAGGGACCATG
GCCGCGACGACAACAGCCATCAACGACCCTCCCGTCAAGTTCATCGACAACGACGCCGCCAGAACAGAAGTCACC
GGCCACGAAGCCATCATGCTCTACCTAGACTCCTTCTACGGAGGCGGCCAAACCTCTCCACGCAACGAACTAGCC
CTCCGATACACCCACTTCCAACGAGCCACCCGCCTCCTCCATCTCTCCCGCTCACCCCCCAACCAAGACGCAGCC
GCGCCCCCCAAACCCCTAAGCAGCGAACTCGACGCCTGGAACACCATCCTGGAGCGCGCCCCGTCGCGGCCCTTC
CTCGCCGGCGCGGCCCCTTCGCTGCCTGACTTTGCGCTCTGGCCTGTTCTGCATGCTGTGGTGGAGCGGTGCGGA
GGCGGGGATGTTGTTCTTGGTCGGTTGGAAGGGTTGCGTCGTTACTATGATGCCGTTGCTGCGCGGGAGAGCGTC
AGGGGTATTCTTGAGAGACGGTGA
Transcript >Ophun1|5461
ATGTTTCCCTTCGACACGGCCGCCCTGCCCCAGCTGACGACCCGCAAGGCCCTGATCGCCGTCGACTTGCAAAAT
GACTTTGTTGGACTCGACGGTGAAGCGACGCTGCCTGTTCGTGAACCGGAAGGCTTCGTCGCCCGCGTCGTGGCC
TTGTCCGAGGCCTTTCGTGCCGTGGGTGACGTCGTCTGGGTCCAGTCGCGCTTCGACGAACCACGGCCGGAGCCA
GGTCCGGAGGAGAGCCCGGCCGGCGATCCGGAGGCATTCCTCAGCGACGAGGCCTTTGATTGCGTCAGAGCCGAC
TCTTCAGGGGCCGAGATGGCGCCAATGGTCCAGGCCGCCGTCCGACCCCGTGACGCCGTCCTCACCAAGACGCAT
TACTCGGCCTTTCAGGAAACGGCCCTGCTGCGCGTCCTGCGCGCCCACATGGTCATGGAGGTCTTTCTCTGCGGT
TCCCTGACCAACGTGGGCGTCTATGCCACCGCCATCGACGCAGCCTGCCACGGCATGGCCATCACCCTCGTCGAG
GACTGCTGCGGCTACCGAAGCAACGGGCGTAGGGCCAGGGCTGTAAAGAGCCTCGTCGAGCTCACGGGCTGTGAT
GTTGCCAGTAGCAAAGAGGTCTTGCTCCTGATTCGGCCCAAGCAGCCAGTGTTGCCATCGAAGCAGAACGAGGAT
AAGCCACCGACGTCGATCGACCTGGTTAAGTCCATGAAGGGACTAAGCATCGTCAGCGACTCGCCGCGAGACGGA
GCTGATAAATCGAAGTCGACTTCAAAGACAACATTGAAATCGTCTTCTCTTGCCTCTTCCCCTACTGGTTCGTCT
AACCCTTCAGCGGCTGCGGCTCACGGCAATGGAGCCGATGATGGTGGTGATGATGACGATGACGATGACGATGAC
GATGACGATGACGATGACGACGACGATGACGATGACGGCGACGGCGACGACGACAATGACAATGACGATGACCGT
TGCAGGGCATCTCCCAAGGACACAACAACCTCAGTCAAGCTTGACGCTCGGCAAAGAACTCCAACTCCACTGGCA
TCCACGCCTTCTACAGTCTCGTCAACCGCAACAACGGCAACGAAAGACGACGACTGCCCACCCCTCTGCGAAGGC
GACACGCACGTCATTCTCAACGCCCTCCCCTCCTCGCTCGAGCACGACATCTTCTCCCGGCTCCGGAACGAGGTC
GACTGGCAGCCCATGAGCCACCAGGGAAGCCCTGTTCCCCGGCTCGTGGCTGTCCAGGGCACCATCTCGACCGAC
GGATCCGTGCCCGTCTACCGGCACCCGGCCGACGAGTCTCCAGCTCTCCTGCCCTTTTCGAAGACGGTGCTGGCC
GTCAAGGATCAGGTCGAGCATCACGTCGGCCACCCAGTCAACCACGTTCTCATCCAGCTATACCGCGACGGCAAT
GACTACATCTCGGAACACAGCGATAAGACGCTCGACATCGTGCCCGGCTCCTTCATCGCAAACGTCAGCCTCGGC
GCCCAACGGACCATGGTGCTGCGAACCAAGAGACGCGCCCCCGGTGAGAGCCGTCAAGTTCAGCGGGCAACGCTG
CCTCACAACTCGCTGTGTCGCATGGGCCTGCGCACCAACATGAAATGGCTCCACGCCATCCGTCAGGACCGTCGC
GCCGACCGCGATAAGACGCCGGACGAGCTGGCCTTTGACGGTGCCCGTATCTCACTCACCTTCCGCCGTATCGGC
ACCTTTCTCGACCCGGAGCGAGGCCTCATCTGGGGCCAGGGCGCCAGGGGTAAGACGCGCGCCGATGCTCGACCC
GTCATCAACGGTCAGGGCCCCGAGGCTGTCGCCATGCTTCGCGCTTTTGGAGCAGAGAACCACGGGTCAGTGGTC
GACTGGGATGCTCTCTACGGCGACGGCTTCGACCAACTGCACATCCACGCCGCGCCTCGTCTCTTCGCCTCGGCC
GACGACACCGTCATCAACATGCAACTCTCTCTCATGCTAGCTGAGCTCGGCGTCTCCCATGCCAAAGGGACCATG
GCCGCGACGACAACAGCCATCAACGACCCTCCCGTCAAGTTCATCGACAACGACGCCGCCAGAACAGAAGTCACC
GGCCACGAAGCCATCATGCTCTACCTAGACTCCTTCTACGGAGGCGGCCAAACCTCTCCACGCAACGAACTAGCC
CTCCGATACACCCACTTCCAACGAGCCACCCGCCTCCTCCATCTCTCCCGCTCACCCCCCAACCAAGACGCAGCC
GCGCCCCCCAAACCCCTAAGCAGCGAACTCGACGCCTGGAACACCATCCTGGAGCGCGCCCCGTCGCGGCCCTTC
CTCGCCGGCGCGGCCCCTTCGCTGCCTGACTTTGCGCTCTGGCCTGTTCTGCATGCTGTGGTGGAGCGGTGCGGA
GGCGGGGATGTTGTTCTTGGTCGGTTGGAAGGGTTGCGTCGTTACTATGATGCCGTTGCTGCGCGGGAGAGCGTC
AGGGGTATTCTTGAGAGACGGTGA
Gene >Ophun1|5461
ATGTTTCCCTTCGACACGGCCGCCCTGCCCCAGCTGACGACCCGCAAGGCCCTGATCGCCGTCGACTTGCAAAAT
GACTTTGTTGGACTCGACGGTGAAGCGACGCTGCCTGTTCGTGAACCGGAAGGCTTCGTCGCCCGCGTCGTGGCC
TTGTCCGAGGCCTTTCGTGCCGTGGGTGACGTCGTCTGGGTCCAGTCGCGCTTCGACGAACCACGGCCGGAGCCA
GGTCCGGAGGAGAGCCCGGCCGGCGATCCGGAGGCATTCCTCAGCGACGAGGCCTTTGATTGCGTCAGAGCCGAC
TCTTCAGGGGCCGAGATGGCGCCAATGGTCCAGGCCGCCGTCCGACCCCGTGACGCCGTCCTCACCAAGACGCAT
TACTCGGCCTTTCAGGAAACGGCCCTGCTGCGCGTCCTGCGCGCCCACATGGTCATGGAGGTCTTTCTCTGCGGT
TCCCTGACCAACGTGGGCGTCTATGCCACCGCCATCGACGCAGCCTGCCACGGCATGGCCATCACCCTCGTCGAG
GACTGCTGCGGCTACCGAAGCAACGGGCGTAGGGCCAGGGCTGTAAAGAGCCTCGTCGAGCTCACGGGCTGTGAT
GTTGCCAGTAGCAAAGAGGTCTTGCTCCTGATTCGGCCCAAGCAGCCAGTGTTGCCATCGAAGCAGAACGAGGAT
AAGCCACCGACGTCGATCGACCTGGTTAAGTCCATGAAGGGACTAAGCATCGTCAGCGACTCGCCGCGAGACGGA
GCTGATAAATCGAAGTCGACTTCAAAGACAACATTGAAATCGTCTTCTCTTGCCTCTTCCCCTACTGGTTCGTCT
AACCCTTCAGCGGCTGCGGCTCACGGCAATGGAGCCGATGATGGTGGTGATGATGACGATGACGATGACGATGAC
GATGACGATGACGATGACGACGACGATGACGATGACGGCGACGGCGACGACGACAATGACAATGACGATGACCGT
TGCAGGGCATCTCCCAAGGACACAACAACCTCAGTCAAGCTTGACGCTCGGCAAAGAACTCCAACTCCACTGGCA
TCCACGCCTTCTACAGTCTCGTCAACCGCAACAACGGCAACGAAAGACGACGACTGCCCACCCCTCTGCGAAGGC
GACACGCACGTCATTCTCAACGCCCTCCCCTCCTCGCTCGAGCACGACATCTTCTCCCGGCTCCGGAACGAGGTC
GACTGGCAGCCCATGAGCCACCAGGGAAGCCCTGTTCCCCGGCTCGTGGCTGTCCAGGGCACCATCTCGACCGAC
GGATCCGTGCCCGTCTACCGGCACCCGGCCGACGAGTCTCCAGCTCTCCTGCCCTTTTCGAAGACGGTGCTGGCC
GTCAAGGATCAGGTCGAGCATCACGTCGGCCACCCAGTCAACCACGTTCTCATCCAGCTATACCGCGACGGCAAT
GACTACATCTCGGAACACAGCGATAAGACGCTCGACATCGTGCCCGGCTCCTTCATCGCAAACGTCAGCCTCGGC
GCCCAACGGACCATGGTGCTGCGAACCAAGAGACGCGCCCCCGGTGAGAGCCGTCAAGTTCAGCGGGCAACGCTG
CCTCACAACTCGCTGTGTCGCATGGGCCTGCGCACCAACATGAAATGGCTCCACGCCATCCGTCAGGACCGTCGC
GCCGACCGCGATAAGACGCCGGACGAGCTGGCCTTTGACGGTGCCCGTATCTCACTCACCTTCCGCCGTATCGGC
ACCTTTCTCGACCCGGAGCGAGGCCTCATCTGGGGCCAGGGCGCCAGGGGTAAGACGCGCGCCGATGCTCGACCC
GTCATCAACGGTCAGGGCCCCGAGGCTGTCGCCATGCTTCGCGCTTTTGGAGCAGAGAACCACGGGTCAGTGGTC
GACTGGGATGCTCTCTACGGCGACGGCTTCGACCAACTGCACATCCACGCCGCGCCTCGTCTCTTCGCCTCGGCC
GACGACACCGTCATCAACATGCAACTCTCTCTCATGCTAGCTGAGCTCGGCGTCTCCCATGCCAAAGGGACCATG
GCCGCGACGACAACAGCCATCAACGACCCTCCCGTCAAGTTCATCGACAACGACGCCGCCAGAACAGAAGTCACC
GGCCACGAAGCCATCATGCTCTACCTAGACTCCTTCTACGGAGGCGGCCAAACCTCTCCACGCAACGAACTAGCC
CTCCGATACACCCACTTCCAACGAGCCACCCGCCTCCTCCATCTCTCCCGCTCACCCCCCAACCAAGACGCAGCC
GCGCCCCCCAAACCCCTAAGCAGCGAACTCGACGCCTGGAACACCATCCTGGAGCGCGCCCCGTCGCGGCCCTTC
CTCGCCGGCGCGGCCCCTTCGCTGCCTGACTTTGCGCTCTGGCCTGTTCTGCATGCTGTGGTGGAGCGGTGCGGA
GGCGGGGATGTTGTTCTTGGTCGGTTGGAAGGGTTGCGTCGTTACTATGATGCCGTTGCTGCGCGGGAGAGCGTC
AGGGGTATTCTTGAGAGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail