Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5460
Gene name
LocationContig_54:36059..37774
Strand+
Gene length (bp)1715
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00464 SHMT Serine hydroxymethyltransferase 1.1E-196 45 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S5N8|GLYM_NEUCR Putative serine hydroxymethyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-2 PE=3 SV=2 15 517 0.0E+00
sp|Q10104|GLYM_SCHPO Serine hydroxymethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shm2 PE=3 SV=2 37 512 0.0E+00
sp|Q9SZJ5|GLYM1_ARATH Serine hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1 41 510 0.0E+00
sp|P50433|GLYM_SOLTU Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1 27 510 0.0E+00
sp|O13426|GLYC_CANAL Serine hydroxymethyltransferase, cytosolic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHM2 PE=1 SV=4 37 511 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S5N8|GLYM_NEUCR Putative serine hydroxymethyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cbs-2 PE=3 SV=2 15 517 0.0E+00
sp|Q10104|GLYM_SCHPO Serine hydroxymethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shm2 PE=3 SV=2 37 512 0.0E+00
sp|Q9SZJ5|GLYM1_ARATH Serine hydroxymethyltransferase 1, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1 41 510 0.0E+00
sp|P50433|GLYM_SOLTU Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1 27 510 0.0E+00
sp|O13426|GLYC_CANAL Serine hydroxymethyltransferase, cytosolic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHM2 PE=1 SV=4 37 511 0.0E+00
sp|P34899|GLYM_PEA Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1 41 510 0.0E+00
sp|Q6CLQ5|GLYM_KLULA Serine hydroxymethyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SHM1 PE=3 SV=1 11 512 0.0E+00
sp|P34898|GLYC_NEUCR Serine hydroxymethyltransferase, cytosolic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=for PE=3 SV=2 35 512 0.0E+00
sp|Q6FQ44|GLYM_CANGA Serine hydroxymethyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHM1 PE=3 SV=1 37 512 0.0E+00
sp|O13972|GLYD_SCHPO Probable serine hydroxymethyltransferase, cytosolic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.12c PE=3 SV=1 45 511 0.0E+00
sp|O13425|GLYM_CANAX Serine hydroxymethyltransferase, mitochondrial OS=Candida albicans GN=SHM1 PE=3 SV=1 7 512 0.0E+00
sp|Q75BQ6|GLYC_ASHGO Serine hydroxymethyltransferase, cytosolic OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHM2 PE=3 SV=2 35 512 0.0E+00
sp|P49357|GLYM1_FLAPR Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1 41 510 0.0E+00
sp|Q94C74|GLYM2_ARATH Serine hydroxymethyltransferase 2, mitochondrial OS=Arabidopsis thaliana GN=SHM2 PE=2 SV=2 16 510 0.0E+00
sp|P49358|GLYM2_FLAPR Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1 41 510 0.0E+00
sp|P37292|GLYM_YEAST Serine hydroxymethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHM1 PE=1 SV=2 16 514 0.0E+00
sp|P37291|GLYC_YEAST Serine hydroxymethyltransferase, cytosolic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHM2 PE=1 SV=2 35 511 0.0E+00
sp|Q6FUP6|GLYC_CANGA Serine hydroxymethyltransferase, cytosolic OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHM2 PE=3 SV=1 35 511 0.0E+00
sp|Q758F0|GLYM_ASHGO Serine hydroxymethyltransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHM1 PE=3 SV=1 38 514 0.0E+00
sp|Q60V73|GLYC_CAEBR Serine hydroxymethyltransferase OS=Caenorhabditis briggsae GN=mel-32 PE=3 SV=3 38 514 0.0E+00
sp|P50432|GLYC_CAEEL Serine hydroxymethyltransferase OS=Caenorhabditis elegans GN=mel-32 PE=1 SV=2 37 514 0.0E+00
sp|P34897|GLYM_HUMAN Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens GN=SHMT2 PE=1 SV=3 45 512 0.0E+00
sp|P14519|GLYM_RABIT Serine hydroxymethyltransferase, mitochondrial OS=Oryctolagus cuniculus GN=SHMT2 PE=1 SV=2 5 512 0.0E+00
sp|Q3SZ20|GLYM_BOVIN Serine hydroxymethyltransferase, mitochondrial OS=Bos taurus GN=SHMT2 PE=2 SV=1 11 512 0.0E+00
sp|P35623|GLYC_SHEEP Serine hydroxymethyltransferase, cytosolic OS=Ovis aries GN=SHMT1 PE=1 SV=3 37 512 0.0E+00
sp|Q94JQ3|GLYP3_ARATH Serine hydroxymethyltransferase 3, chloroplastic OS=Arabidopsis thaliana GN=SHM3 PE=1 SV=2 45 512 0.0E+00
sp|Q5E9P9|GLYC_BOVIN Serine hydroxymethyltransferase, cytosolic OS=Bos taurus GN=SHMT1 PE=2 SV=3 37 512 3.0E-180
sp|P34896|GLYC_HUMAN Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens GN=SHMT1 PE=1 SV=1 39 512 5.0E-176
sp|P50431|GLYC_MOUSE Serine hydroxymethyltransferase, cytosolic OS=Mus musculus GN=Shmt1 PE=1 SV=3 37 512 1.0E-175
sp|Q5RFK5|GLYC_PONAB Serine hydroxymethyltransferase, cytosolic OS=Pongo abelii GN=SHMT1 PE=2 SV=1 39 512 2.0E-175
sp|P07511|GLYC_RABIT Serine hydroxymethyltransferase, cytosolic OS=Oryctolagus cuniculus GN=SHMT1 PE=1 SV=2 37 512 2.0E-173
sp|Q54Z26|GLYC1_DICDI Serine hydroxymethyltransferase 1 OS=Dictyostelium discoideum GN=shmt1 PE=1 SV=1 45 512 8.0E-161
sp|O23254|GLYC4_ARATH Serine hydroxymethyltransferase 4 OS=Arabidopsis thaliana GN=SHM4 PE=1 SV=1 45 512 4.0E-160
sp|Q54EW1|GLYC2_DICDI Serine hydroxymethyltransferase 2 OS=Dictyostelium discoideum GN=shmt2 PE=3 SV=1 45 512 5.0E-156
sp|Q9SVM4|GLYC5_ARATH Serine hydroxymethyltransferase 5 OS=Arabidopsis thaliana GN=SHM5 PE=3 SV=1 42 512 5.0E-156
sp|Q9LM59|GLYC6_ARATH Serine hydroxymethyltransferase 6 OS=Arabidopsis thaliana GN=SHM6 PE=2 SV=1 45 512 2.0E-139
sp|Q84WV0|GLYC7_ARATH Serine hydroxymethyltransferase 7 OS=Arabidopsis thaliana GN=SHM7 PE=2 SV=1 48 512 4.0E-138
sp|O62585|GLYC_ENCCU Serine hydroxymethyltransferase, cytosolic OS=Encephalitozoon cuniculi (strain GB-M1) GN=SHMT-1 PE=3 SV=2 37 459 6.0E-132
sp|A4XL61|GLYA_CALS8 Serine hydroxymethyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=glyA PE=3 SV=1 45 454 9.0E-122
sp|B1V975|GLYA_PHYAS Serine hydroxymethyltransferase OS=Phytoplasma australiense GN=glyA PE=3 SV=1 41 454 1.0E-120
sp|B9MR57|GLYA_CALBD Serine hydroxymethyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=glyA PE=3 SV=1 45 454 4.0E-120
sp|C5CEA8|GLYA_KOSOT Serine hydroxymethyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=glyA PE=3 SV=1 45 476 7.0E-120
sp|B9KAQ7|GLYA_THENN Serine hydroxymethyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=glyA PE=3 SV=1 44 480 8.0E-120
sp|Q97GV1|GLYA_CLOAB Serine hydroxymethyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glyA PE=3 SV=1 44 454 3.0E-119
sp|B2A3H6|GLYA_NATTJ Serine hydroxymethyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glyA PE=3 SV=1 44 454 4.0E-119
sp|Q3APN5|GLYA_CHLCH Serine hydroxymethyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=glyA PE=3 SV=1 45 461 4.0E-119
sp|Q2NIT8|GLYA_AYWBP Serine hydroxymethyltransferase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=glyA PE=3 SV=1 45 454 8.0E-119
sp|Q8PZQ0|GLYA_METMA Serine hydroxymethyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=glyA PE=3 SV=2 43 454 2.0E-118
sp|A5IGI2|GLYA_LEGPC Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Corby) GN=glyA PE=3 SV=1 42 451 2.0E-118
sp|B3R0G5|GLYA_PHYMT Serine hydroxymethyltransferase OS=Phytoplasma mali (strain AT) GN=glyA PE=3 SV=1 49 455 2.0E-118
sp|A7GGI2|GLYA_CLOBL Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=glyA PE=3 SV=1 43 454 2.0E-118
sp|Q5ZXK6|GLYA_LEGPH Serine hydroxymethyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=glyA PE=3 SV=1 42 451 4.0E-118
sp|Q5X722|GLYA_LEGPA Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Paris) GN=glyA PE=3 SV=1 42 451 4.0E-118
sp|A8F595|GLYA_PSELT Serine hydroxymethyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=glyA PE=3 SV=1 44 486 5.0E-118
sp|Q8R887|GLYA_CALS4 Serine hydroxymethyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glyA PE=3 SV=1 45 486 5.0E-118
sp|Q5WYH4|GLYA_LEGPL Serine hydroxymethyltransferase OS=Legionella pneumophila (strain Lens) GN=glyA PE=3 SV=1 42 451 6.0E-118
sp|B1IJJ8|GLYA_CLOBK Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=glyA PE=3 SV=1 43 454 7.0E-118
sp|Q6YR37|GLYA_ONYPE Serine hydroxymethyltransferase OS=Onion yellows phytoplasma (strain OY-M) GN=glyA PE=3 SV=1 45 454 7.0E-118
sp|B5YFZ0|GLYA_THEYD Serine hydroxymethyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glyA PE=3 SV=1 45 454 8.0E-118
sp|B4SE31|GLYA_PELPB Serine hydroxymethyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=glyA PE=3 SV=1 45 461 8.0E-118
sp|Q6G3L3|GLYA_BARHE Serine hydroxymethyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glyA PE=3 SV=1 35 511 1.0E-117
sp|Q8TK94|GLYA_METAC Serine hydroxymethyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=glyA PE=3 SV=1 43 454 1.0E-117
sp|A9NEA9|GLYA_ACHLI Serine hydroxymethyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=glyA PE=3 SV=1 45 455 3.0E-117
sp|B9DMF3|GLYA_STACT Serine hydroxymethyltransferase OS=Staphylococcus carnosus (strain TM300) GN=glyA PE=3 SV=1 45 454 4.0E-117
sp|Q3A934|GLYA_CARHZ Serine hydroxymethyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=glyA PE=3 SV=1 41 471 4.0E-117
sp|B1KXQ5|GLYA_CLOBM Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=glyA PE=3 SV=1 43 454 5.0E-117
sp|C3L181|GLYA_CLOB6 Serine hydroxymethyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=glyA PE=3 SV=1 43 454 5.0E-117
sp|C1FTF1|GLYA_CLOBJ Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=glyA PE=3 SV=1 43 454 7.0E-117
sp|Q8EM73|GLYA_OCEIH Serine hydroxymethyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glyA PE=3 SV=1 45 450 8.0E-117
sp|A5I526|GLYA_CLOBH Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=glyA PE=3 SV=1 43 454 1.0E-116
sp|A7FWM6|GLYA_CLOB1 Serine hydroxymethyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=glyA PE=3 SV=1 43 454 1.0E-116
sp|B0K631|GLYA_THEPX Serine hydroxymethyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=glyA PE=3 SV=1 45 484 3.0E-116
sp|B0K742|GLYA_THEP3 Serine hydroxymethyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glyA PE=3 SV=1 45 484 3.0E-116
sp|B2TN52|GLYA_CLOBB Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glyA PE=3 SV=1 44 454 4.0E-116
sp|A2CCJ3|GLYA_PROM3 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9303) GN=glyA PE=3 SV=1 41 482 4.0E-116
sp|B2KER5|GLYA_ELUMP Serine hydroxymethyltransferase OS=Elusimicrobium minutum (strain Pei191) GN=glyA PE=3 SV=1 41 511 6.0E-116
sp|B2V398|GLYA_CLOBA Serine hydroxymethyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glyA PE=3 SV=1 44 454 6.0E-116
sp|Q4L7Z4|GLYA_STAHJ Serine hydroxymethyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glyA PE=3 SV=1 43 482 9.0E-116
sp|A0M3N2|GLYA_GRAFK Serine hydroxymethyltransferase OS=Gramella forsetii (strain KT0803) GN=glyA PE=3 SV=1 49 454 1.0E-115
sp|B3EMW0|GLYA_CHLPB Serine hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=glyA PE=3 SV=2 45 457 1.0E-115
sp|P66804|GLYA_STAAW Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain MW2) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|Q6G7J7|GLYA_STAAS Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|Q6GEW2|GLYA_STAAR Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|P99091|GLYA_STAAN Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain N315) GN=glyA PE=1 SV=1 43 482 2.0E-115
sp|P66803|GLYA_STAAM Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|A6QIV7|GLYA_STAAE Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain Newman) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|Q5HE87|GLYA_STAAC Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain COL) GN=glyA PE=1 SV=1 43 482 2.0E-115
sp|A5IUQ8|GLYA_STAA9 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain JH9) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|Q2FWE5|GLYA_STAA8 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|A6U3J8|GLYA_STAA2 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain JH1) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|A7X4V7|GLYA_STAA1 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|Q6AM21|GLYA_DESPS Serine hydroxymethyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=glyA PE=3 SV=1 45 454 2.0E-115
sp|A8YY80|GLYA_STAAT Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|Q2FF15|GLYA_STAA3 Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain USA300) GN=glyA PE=3 SV=1 43 482 2.0E-115
sp|A4J9B1|GLYA_DESRM Serine hydroxymethyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=glyA PE=3 SV=1 40 476 3.0E-115
sp|B9E8F5|GLYA_MACCJ Serine hydroxymethyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=glyA PE=3 SV=1 43 471 3.0E-115
sp|Q2YUJ1|GLYA_STAAB Serine hydroxymethyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glyA PE=3 SV=1 43 482 3.0E-115
sp|Q7V4U3|GLYA_PROMM Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=glyA PE=3 SV=1 41 486 5.0E-115
sp|A1WVG6|GLYA_HALHL Serine hydroxymethyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=glyA PE=3 SV=1 56 450 6.0E-115
sp|A1BE30|GLYA_CHLPD Serine hydroxymethyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=glyA PE=3 SV=1 45 460 6.0E-115
sp|A7HJ69|GLYA_FERNB Serine hydroxymethyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glyA PE=3 SV=1 45 450 8.0E-115
sp|Q49Z60|GLYA_STAS1 Serine hydroxymethyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glyA PE=3 SV=1 45 450 1.0E-114
sp|Q0IDD8|GLYA_SYNS3 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9311) GN=glyA PE=3 SV=1 41 450 1.0E-114
sp|Q46A52|GLYA_METBF Serine hydroxymethyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=glyA PE=1 SV=1 43 454 2.0E-114
sp|Q8CRN3|GLYA_STAES Serine hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glyA PE=3 SV=1 43 454 2.0E-114
sp|Q5HMB0|GLYA_STAEQ Serine hydroxymethyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glyA PE=3 SV=1 43 454 2.0E-114
sp|A5CYB7|GLYA_PELTS Serine hydroxymethyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=glyA PE=3 SV=1 45 454 2.0E-114
sp|A0L403|GLYA_MAGMM Serine hydroxymethyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=glyA PE=3 SV=1 42 454 3.0E-114
sp|Q5KUI2|GLYA_GEOKA Serine hydroxymethyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=glyA PE=3 SV=1 44 450 5.0E-114
sp|C4ZH69|GLYA_EUBR3 Serine hydroxymethyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=glyA PE=3 SV=1 45 476 5.0E-114
sp|Q3B2I7|GLYA_CHLL7 Serine hydroxymethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=glyA PE=3 SV=1 45 470 5.0E-114
sp|A6LKU9|GLYA_THEM4 Serine hydroxymethyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glyA PE=3 SV=1 44 454 5.0E-114
sp|B7IHE6|GLYA_THEAB Serine hydroxymethyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glyA PE=3 SV=1 44 450 6.0E-114
sp|A5IJ65|GLYA_THEP1 Serine hydroxymethyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glyA PE=3 SV=1 44 438 6.0E-114
sp|Q0SRQ2|GLYA_CLOPS Serine hydroxymethyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=glyA PE=3 SV=1 44 454 7.0E-114
sp|Q7VDS8|GLYA_PROMA Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=glyA PE=3 SV=1 41 450 8.0E-114
sp|B8I2N8|GLYA_CLOCE Serine hydroxymethyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glyA PE=3 SV=1 45 455 1.0E-113
sp|B1L7Y6|GLYA_THESQ Serine hydroxymethyltransferase OS=Thermotoga sp. (strain RQ2) GN=glyA PE=3 SV=1 44 438 1.0E-113
sp|Q8XJ32|GLYA_CLOPE Serine hydroxymethyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=glyA PE=3 SV=1 44 454 1.0E-113
sp|A4ITJ9|GLYA_GEOTN Serine hydroxymethyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glyA PE=3 SV=1 44 450 2.0E-113
sp|B4S5Y9|GLYA_PROA2 Serine hydroxymethyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=glyA PE=3 SV=1 45 511 2.0E-113
sp|A5N7P5|GLYA_CLOK5 Serine hydroxymethyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glyA PE=3 SV=1 45 454 2.0E-113
sp|B9E156|GLYA_CLOK1 Serine hydroxymethyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=glyA PE=3 SV=1 45 454 2.0E-113
sp|B1I6M4|GLYA_DESAP Serine hydroxymethyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=glyA PE=3 SV=1 45 450 2.0E-113
sp|Q5N2P9|GLYA_SYNP6 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=glyA PE=3 SV=2 45 459 2.0E-113
sp|Q31RK5|GLYA_SYNE7 Serine hydroxymethyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=glyA PE=3 SV=1 45 459 2.0E-113
sp|A0LI16|GLYA_SYNFM Serine hydroxymethyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=glyA PE=3 SV=1 45 511 2.0E-113
sp|Q0TP32|GLYA_CLOP1 Serine hydroxymethyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glyA PE=3 SV=1 44 454 3.0E-113
sp|A1USI0|GLYA_BARBK Serine hydroxymethyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=glyA PE=3 SV=1 35 454 3.0E-113
sp|Q3AW18|GLYA_SYNS9 Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9902) GN=glyA PE=3 SV=1 38 450 4.0E-113
sp|A3DEB1|GLYA_CLOTH Serine hydroxymethyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glyA PE=3 SV=1 45 454 4.0E-113
sp|A0B8J6|GLYA_METTP Serine hydroxymethyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=glyA PE=3 SV=1 45 454 4.0E-113
sp|Q1RGX5|GLYA_RICBR Serine hydroxymethyltransferase OS=Rickettsia bellii (strain RML369-C) GN=glyA PE=3 SV=1 39 451 5.0E-113
sp|A8GUH4|GLYA_RICB8 Serine hydroxymethyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=glyA PE=3 SV=1 39 451 5.0E-113
sp|Q9WZH9|GLYA_THEMA Serine hydroxymethyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glyA PE=3 SV=1 44 438 5.0E-113
sp|Q2IWS4|GLYA_RHOP2 Serine hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=glyA PE=3 SV=1 25 471 6.0E-113
sp|A9BIK8|GLYA_PETMO Serine hydroxymethyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=glyA PE=3 SV=1 45 452 7.0E-113
sp|A5WH82|GLYA_PSYWF Serine hydroxymethyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=glyA PE=3 SV=1 45 482 1.0E-112
sp|Q5SI56|GLYA_THET8 Serine hydroxymethyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glyA PE=1 SV=1 47 454 1.0E-112
sp|Q8YMW8|GLYA_NOSS1 Serine hydroxymethyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glyA PE=3 SV=1 42 450 1.0E-112
sp|Q74CR5|GLYA_GEOSL Serine hydroxymethyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glyA PE=3 SV=1 45 455 2.0E-112
sp|Q72IH2|GLYA_THET2 Serine hydroxymethyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glyA PE=3 SV=2 47 454 2.0E-112
sp|A5GIG4|GLYA_SYNPW Serine hydroxymethyltransferase OS=Synechococcus sp. (strain WH7803) GN=glyA PE=3 SV=1 34 450 2.0E-112
sp|Q3A4L9|GLYA_PELCD Serine hydroxymethyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=glyA PE=3 SV=1 41 454 2.0E-112
sp|Q2G646|GLYA_NOVAD Serine hydroxymethyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=glyA PE=3 SV=1 40 454 3.0E-112
sp|B8FJ72|GLYA_DESAA Serine hydroxymethyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=glyA PE=3 SV=1 45 450 3.0E-112
sp|Q0ABQ9|GLYA_ALKEH Serine hydroxymethyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=glyA PE=3 SV=1 49 451 4.0E-112
sp|A8MGL7|GLYA_ALKOO Serine hydroxymethyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=glyA PE=3 SV=1 45 463 5.0E-112
sp|B3EFN5|GLYA_CHLL2 Serine hydroxymethyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=glyA PE=3 SV=2 45 457 5.0E-112
sp|A6LUK9|GLYA_CLOB8 Serine hydroxymethyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glyA PE=3 SV=1 44 454 6.0E-112
sp|B0CEI9|GLYA_ACAM1 Serine hydroxymethyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=glyA PE=3 SV=1 45 459 7.0E-112
sp|Q7MXW0|GLYA_PORGI Serine hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=glyA PE=3 SV=1 47 482 7.0E-112
sp|B2RGR2|GLYA_PORG3 Serine hydroxymethyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=glyA PE=3 SV=1 47 482 7.0E-112
sp|A0LV49|GLYA_ACIC1 Serine hydroxymethyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=glyA PE=3 SV=1 43 471 1.0E-111
sp|A4SFY3|GLYA_CHLPM Serine hydroxymethyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=glyA PE=3 SV=1 45 454 1.0E-111
sp|A0PZX4|GLYA_CLONN Serine hydroxymethyltransferase OS=Clostridium novyi (strain NT) GN=glyA PE=3 SV=1 44 454 1.0E-111
sp|C6E348|GLYA_GEOSM Serine hydroxymethyltransferase OS=Geobacter sp. (strain M21) GN=glyA PE=3 SV=1 45 486 1.0E-111
sp|Q6G009|GLYA_BARQU Serine hydroxymethyltransferase OS=Bartonella quintana (strain Toulouse) GN=glyA PE=3 SV=1 35 511 1.0E-111
sp|Q88Q27|GLYA2_PSEPK Serine hydroxymethyltransferase 2 OS=Pseudomonas putida (strain KT2440) GN=glyA2 PE=3 SV=1 45 447 1.0E-111
sp|B7JYG9|GLYA_CYAP8 Serine hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=glyA PE=3 SV=1 35 450 3.0E-111
sp|C1DEQ3|GLYA_AZOVD Serine hydroxymethyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glyA PE=3 SV=1 45 442 3.0E-111
sp|Q2LQM6|GLYA_SYNAS Serine hydroxymethyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=glyA PE=3 SV=1 45 450 3.0E-111
sp|B5E8U0|GLYA_GEOBB Serine hydroxymethyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=glyA PE=3 SV=1 45 450 3.0E-111
sp|Q1D345|GLYA_MYXXD Serine hydroxymethyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=glyA PE=3 SV=1 45 450 3.0E-111
sp|Q3AN03|GLYA_SYNSC Serine hydroxymethyltransferase OS=Synechococcus sp. (strain CC9605) GN=glyA PE=3 SV=1 41 484 3.0E-111
sp|Q111H1|GLYA_TRIEI Serine hydroxymethyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=glyA PE=3 SV=1 45 459 4.0E-111
sp|Q65DW5|GLYA_BACLD Serine hydroxymethyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glyA PE=3 SV=1 44 482 4.0E-111
sp|Q983B6|GLYA1_RHILO Serine hydroxymethyltransferase 1 OS=Rhizobium loti (strain MAFF303099) GN=glyA1 PE=3 SV=1 28 450 5.0E-111
sp|Q48CP3|GLYA2_PSE14 Serine hydroxymethyltransferase 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glyA2 PE=3 SV=1 44 451 5.0E-111
sp|P77962|GLYA_SYNY3 Serine hydroxymethyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glyA PE=3 SV=1 45 486 5.0E-111
sp|A2BUN9|GLYA_PROM5 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=glyA PE=3 SV=1 44 450 6.0E-111
sp|Q3K6J0|GLYA2_PSEPF Serine hydroxymethyltransferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA2 PE=3 SV=1 45 447 6.0E-111
sp|Q39V87|GLYA_GEOMG Serine hydroxymethyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glyA PE=3 SV=1 45 455 7.0E-111
sp|B8E008|GLYA_DICTD Serine hydroxymethyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=glyA PE=3 SV=1 44 455 8.0E-111
sp|B0JPX8|GLYA_MICAN Serine hydroxymethyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=glyA PE=3 SV=1 45 459 9.0E-111
sp|Q4K5R9|GLYA1_PSEF5 Serine hydroxymethyltransferase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glyA1 PE=3 SV=1 45 447 9.0E-111
sp|Q9RYB2|GLYA_DEIRA Serine hydroxymethyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glyA PE=3 SV=2 49 454 1.0E-110
sp|Q46HB6|GLYA_PROMT Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=glyA PE=3 SV=1 47 450 1.0E-110
sp|B3PBD6|GLYA_CELJU Serine hydroxymethyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=glyA PE=3 SV=1 49 450 1.0E-110
sp|Q07MT9|GLYA_RHOP5 Serine hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=glyA PE=3 SV=1 25 476 1.0E-110
sp|B1YEH3|GLYA_EXIS2 Serine hydroxymethyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glyA PE=3 SV=1 38 451 2.0E-110
sp|Q4ZM83|GLYA2_PSEU2 Serine hydroxymethyltransferase 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glyA2 PE=3 SV=1 44 451 2.0E-110
sp|P39148|GLYA_BACSU Serine hydroxymethyltransferase OS=Bacillus subtilis (strain 168) GN=glyA PE=1 SV=1 44 482 3.0E-110
sp|B2IJJ3|GLYA_BEII9 Serine hydroxymethyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=glyA PE=3 SV=1 28 450 4.0E-110
sp|B3E1Z8|GLYA_GEOLS Serine hydroxymethyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=glyA PE=3 SV=1 45 455 4.0E-110
sp|Q481S6|GLYA2_COLP3 Serine hydroxymethyltransferase 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glyA2 PE=3 SV=1 49 476 4.0E-110
sp|O08370|GLYA_RICPR Serine hydroxymethyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=glyA PE=3 SV=1 39 450 4.0E-110
sp|Q87WC1|GLYA2_PSESM Serine hydroxymethyltransferase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glyA2 PE=3 SV=1 45 447 4.0E-110
sp|A5FS31|GLYA_DEHMB Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=glyA PE=3 SV=1 45 438 5.0E-110
sp|Q3ZZG3|GLYA_DEHMC Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=glyA PE=3 SV=1 45 438 5.0E-110
sp|A9IVC5|GLYA_BART1 Serine hydroxymethyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=glyA PE=3 SV=1 35 511 6.0E-110
sp|A2C090|GLYA_PROM1 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=glyA PE=3 SV=1 47 450 6.0E-110
sp|A4VI36|GLYA_PSEU5 Serine hydroxymethyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=glyA PE=3 SV=1 45 451 7.0E-110
sp|Q31CS4|GLYA_PROM9 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=glyA PE=3 SV=1 44 471 8.0E-110
sp|Q88AD1|GLYA1_PSESM Serine hydroxymethyltransferase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glyA1 PE=3 SV=1 44 451 8.0E-110
sp|A9BDM9|GLYA_PROM4 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=glyA PE=3 SV=1 41 450 9.0E-110
sp|B5YDB7|GLYA_DICT6 Serine hydroxymethyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=glyA PE=3 SV=1 44 455 9.0E-110
sp|Q9HTE9|GLYA1_PSEAE Serine hydroxymethyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA1 PE=3 SV=1 40 440 9.0E-110
sp|B9JV74|GLYA_AGRVS Serine hydroxymethyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=glyA PE=3 SV=1 40 482 1.0E-109
sp|Q48DU7|GLYA1_PSE14 Serine hydroxymethyltransferase 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glyA1 PE=3 SV=1 45 447 1.0E-109
sp|Q47WY2|GLYA4_COLP3 Serine hydroxymethyltransferase 4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=glyA4 PE=3 SV=1 49 476 2.0E-109
sp|Q01QZ0|GLYA_SOLUE Serine hydroxymethyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=glyA PE=3 SV=1 37 450 2.0E-109
sp|A3QC57|GLYA_SHELP Serine hydroxymethyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=glyA PE=3 SV=1 49 451 2.0E-109
sp|A5GF66|GLYA_GEOUR Serine hydroxymethyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=glyA PE=3 SV=1 45 486 2.0E-109
sp|B3QPR3|GLYA_CHLP8 Serine hydroxymethyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=glyA PE=3 SV=1 45 470 2.0E-109
sp|Q4ZNH2|GLYA1_PSEU2 Serine hydroxymethyltransferase 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glyA1 PE=3 SV=1 45 447 2.0E-109
sp|Q68W07|GLYA_RICTY Serine hydroxymethyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=glyA PE=3 SV=1 39 450 2.0E-109
sp|Q21NP8|GLYA_SACD2 Serine hydroxymethyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=glyA PE=3 SV=1 45 450 2.0E-109
sp|Q8KC36|GLYA_CHLTE Serine hydroxymethyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=glyA PE=3 SV=1 45 470 2.0E-109
sp|D3DKC4|GLYA_HYDTT Serine hydroxymethyltransferase OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=glyA PE=1 SV=1 44 454 3.0E-109
sp|A0Q7C5|GLYA_FRATN Serine hydroxymethyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=glyA PE=3 SV=1 45 476 3.0E-109
sp|A4SJN4|GLYA_AERS4 Serine hydroxymethyltransferase OS=Aeromonas salmonicida (strain A449) GN=glyA PE=3 SV=1 49 451 3.0E-109
sp|A2BP57|GLYA_PROMS Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=glyA PE=3 SV=1 44 452 3.0E-109
sp|Q7U9J7|GLYA_SYNPX Serine hydroxymethyltransferase OS=Synechococcus sp. (strain WH8102) GN=glyA PE=3 SV=1 57 450 3.0E-109
sp|Q214H7|GLYA_RHOPB Serine hydroxymethyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=glyA PE=3 SV=1 40 471 3.0E-109
sp|Q24MM6|GLYA_DESHY Serine hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glyA PE=3 SV=2 49 455 3.0E-109
sp|B9LKK8|GLYA_CHLSY Serine hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=glyA PE=3 SV=1 44 447 4.0E-109
sp|B4RB35|GLYA_PHEZH Serine hydroxymethyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=glyA PE=3 SV=1 48 463 4.0E-109
sp|A1APU0|GLYA_PELPD Serine hydroxymethyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=glyA PE=3 SV=1 45 455 4.0E-109
sp|A0KNH4|GLYA_AERHH Serine hydroxymethyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=glyA PE=3 SV=1 49 451 4.0E-109
sp|Q3Z9B9|GLYA_DEHM1 Serine hydroxymethyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=glyA PE=3 SV=1 45 438 4.0E-109
sp|Q0HXJ6|GLYA_SHESR Serine hydroxymethyltransferase OS=Shewanella sp. (strain MR-7) GN=glyA PE=3 SV=1 49 453 5.0E-109
sp|A0KU60|GLYA_SHESA Serine hydroxymethyltransferase OS=Shewanella sp. (strain ANA-3) GN=glyA PE=3 SV=1 49 453 5.0E-109
sp|Q831F9|GLYA_ENTFA Serine hydroxymethyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=glyA PE=3 SV=1 49 450 5.0E-109
sp|B8FZ69|GLYA_DESHD Serine hydroxymethyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glyA PE=3 SV=1 49 455 5.0E-109
sp|B0TI64|GLYA_HELMI Serine hydroxymethyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=glyA PE=3 SV=1 44 450 5.0E-109
sp|A1S4B5|GLYA_SHEAM Serine hydroxymethyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=glyA PE=3 SV=1 49 453 6.0E-109
sp|A7GV66|GLYA_BACCN Serine hydroxymethyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glyA PE=3 SV=1 44 484 7.0E-109
sp|B9M0W5|GLYA_GEODF Serine hydroxymethyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=glyA PE=3 SV=1 45 455 8.0E-109
sp|Q8UG75|GLYA1_AGRFC Serine hydroxymethyltransferase 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glyA1 PE=3 SV=2 40 450 8.0E-109
sp|Q1QE01|GLYA_PSYCK Serine hydroxymethyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=glyA PE=3 SV=1 45 440 9.0E-109
sp|A1TYW8|GLYA_MARHV Serine hydroxymethyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=glyA PE=3 SV=1 49 451 1.0E-108
sp|A8EZU3|GLYA_RICCK Serine hydroxymethyltransferase OS=Rickettsia canadensis (strain McKiel) GN=glyA PE=3 SV=1 39 450 1.0E-108
sp|O66776|GLYA_AQUAE Serine hydroxymethyltransferase OS=Aquifex aeolicus (strain VF5) GN=glyA PE=3 SV=1 44 511 1.0E-108
sp|Q64U78|GLYA_BACFR Serine hydroxymethyltransferase OS=Bacteroides fragilis (strain YCH46) GN=glyA PE=3 SV=1 47 482 2.0E-108
sp|Q5LD58|GLYA_BACFN Serine hydroxymethyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=glyA PE=3 SV=1 47 482 2.0E-108
sp|A9WI58|GLYA_CHLAA Serine hydroxymethyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=glyA PE=3 SV=1 44 447 2.0E-108
sp|Q38WJ7|GLYA_LACSS Serine hydroxymethyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=glyA PE=3 SV=1 45 484 2.0E-108
sp|A7Z9Q9|GLYA_BACMF Serine hydroxymethyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glyA PE=3 SV=1 44 454 2.0E-108
sp|Q4FUZ8|GLYA_PSYA2 Serine hydroxymethyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=glyA PE=3 SV=1 59 440 2.0E-108
sp|Q5FNK4|GLYA_GLUOX Serine hydroxymethyltransferase OS=Gluconobacter oxydans (strain 621H) GN=glyA PE=3 SV=1 38 469 2.0E-108
sp|Q4K4P6|GLYA2_PSEF5 Serine hydroxymethyltransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glyA2 PE=3 SV=1 44 451 2.0E-108
sp|Q03EK4|GLYA_PEDPA Serine hydroxymethyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=glyA PE=3 SV=1 47 454 2.0E-108
sp|Q0HL93|GLYA_SHESM Serine hydroxymethyltransferase OS=Shewanella sp. (strain MR-4) GN=glyA PE=3 SV=1 49 453 2.0E-108
sp|Q81JY4|GLYA_BACAN Serine hydroxymethyltransferase OS=Bacillus anthracis GN=glyA PE=3 SV=1 44 484 3.0E-108
sp|C3LFJ0|GLYA_BACAC Serine hydroxymethyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glyA PE=3 SV=1 44 484 3.0E-108
sp|C3P1G5|GLYA_BACAA Serine hydroxymethyltransferase OS=Bacillus anthracis (strain A0248) GN=glyA PE=3 SV=1 44 484 3.0E-108
sp|B7GMG4|GLYA_ANOFW Serine hydroxymethyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=glyA PE=3 SV=1 45 454 3.0E-108
sp|Q88R12|GLYA1_PSEPK Serine hydroxymethyltransferase 1 OS=Pseudomonas putida (strain KT2440) GN=glyA1 PE=3 SV=1 44 451 3.0E-108
sp|Q1J1W0|GLYA_DEIGD Serine hydroxymethyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=glyA PE=3 SV=1 49 454 3.0E-108
sp|A6L5K3|GLYA_BACV8 Serine hydroxymethyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=glyA PE=3 SV=1 47 511 3.0E-108
sp|Q7ND67|GLYA_GLOVI Serine hydroxymethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=glyA PE=3 SV=1 45 450 3.0E-108
sp|B6J8Q9|GLYA_COXB1 Serine hydroxymethyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=glyA PE=3 SV=1 45 482 4.0E-108
sp|A9KSH6|GLYA_CLOPH Serine hydroxymethyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=glyA PE=3 SV=1 56 476 4.0E-108
sp|Q12Q48|GLYA_SHEDO Serine hydroxymethyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=glyA PE=3 SV=1 49 453 4.0E-108
sp|Q8A9S7|GLYA_BACTN Serine hydroxymethyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=glyA PE=3 SV=1 47 484 4.0E-108
sp|Q9I138|GLYA2_PSEAE Serine hydroxymethyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA2 PE=3 SV=1 40 451 5.0E-108
sp|B2SGE5|GLYA_FRATM Serine hydroxymethyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=glyA PE=3 SV=1 45 476 5.0E-108
sp|Q04FR7|GLYA_OENOB Serine hydroxymethyltransferase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=glyA PE=3 SV=1 49 454 5.0E-108
sp|A8FSQ9|GLYA_SHESH Serine hydroxymethyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=glyA PE=3 SV=1 49 451 5.0E-108
sp|B1HM45|GLYA_LYSSC Serine hydroxymethyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=glyA PE=3 SV=1 49 476 6.0E-108
sp|P24060|GLYA_BRADU Serine hydroxymethyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glyA PE=3 SV=2 26 471 6.0E-108
sp|A6WR52|GLYA_SHEB8 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS185) GN=glyA PE=3 SV=1 49 453 6.0E-108
sp|Q0BMN1|GLYA_FRATO Serine hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=glyA PE=3 SV=1 45 476 6.0E-108
sp|Q2A498|GLYA_FRATH Serine hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=glyA PE=3 SV=1 45 476 6.0E-108
sp|A7NB66|GLYA_FRATF Serine hydroxymethyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=glyA PE=3 SV=1 45 476 6.0E-108
sp|C1F0N9|GLYA_BACC3 Serine hydroxymethyltransferase OS=Bacillus cereus (strain 03BB102) GN=glyA PE=3 SV=1 44 484 6.0E-108
sp|B7JGP1|GLYA_BACC0 Serine hydroxymethyltransferase OS=Bacillus cereus (strain AH820) GN=glyA PE=3 SV=1 44 484 6.0E-108
sp|Q0AUC3|GLYA_SYNWW Serine hydroxymethyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=glyA PE=3 SV=1 41 462 6.0E-108
sp|B1GYQ9|GLYA_UNCTG Serine hydroxymethyltransferase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=glyA PE=3 SV=1 44 454 7.0E-108
sp|Q98A81|GLYA2_RHILO Serine hydroxymethyltransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=glyA2 PE=3 SV=1 45 469 7.0E-108
sp|A3PAX9|GLYA_PROM0 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=glyA PE=3 SV=1 44 471 7.0E-108
sp|Q6HAW9|GLYA_BACHK Serine hydroxymethyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glyA PE=3 SV=1 44 484 7.0E-108
sp|A0RLA3|GLYA_BACAH Serine hydroxymethyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=glyA PE=3 SV=1 44 484 7.0E-108
sp|A9KYJ6|GLYA_SHEB9 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS195) GN=glyA PE=3 SV=1 49 453 8.0E-108
sp|B1WPY4|GLYA_CYAA5 Serine hydroxymethyltransferase OS=Cyanothece sp. (strain ATCC 51142) GN=glyA PE=3 SV=1 45 470 8.0E-108
sp|Q9HVI7|GLYA3_PSEAE Serine hydroxymethyltransferase 3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glyA2 PE=3 SV=1 45 442 1.0E-107
sp|Q4UK96|GLYA_RICFE Serine hydroxymethyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=glyA PE=3 SV=1 39 451 1.0E-107
sp|B5ELV3|GLYA_ACIF5 Serine hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=glyA PE=3 SV=1 49 451 1.0E-107
sp|B7J439|GLYA_ACIF2 Serine hydroxymethyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=glyA PE=3 SV=1 49 451 1.0E-107
sp|B1ZZW8|GLYA_OPITP Serine hydroxymethyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=glyA PE=3 SV=1 45 471 1.0E-107
sp|C0QKX3|GLYA_DESAH Serine hydroxymethyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=glyA PE=3 SV=1 45 454 1.0E-107
sp|B2FNK2|GLYA_STRMK Serine hydroxymethyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=glyA PE=3 SV=1 45 451 1.0E-107
sp|A8GPR4|GLYA_RICAH Serine hydroxymethyltransferase OS=Rickettsia akari (strain Hartford) GN=glyA PE=3 SV=1 39 451 1.0E-107
sp|Q8EBN8|GLYA_SHEON Serine hydroxymethyltransferase OS=Shewanella oneidensis (strain MR-1) GN=glyA PE=3 SV=1 49 453 1.0E-107
sp|A4IXD7|GLYA_FRATW Serine hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=glyA PE=3 SV=1 45 476 1.0E-107
sp|Q5NFJ3|GLYA_FRATT Serine hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glyA PE=3 SV=1 45 476 1.0E-107
sp|Q14GZ5|GLYA_FRAT1 Serine hydroxymethyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=glyA PE=3 SV=1 45 476 1.0E-107
sp|B7HFL3|GLYA_BACC4 Serine hydroxymethyltransferase OS=Bacillus cereus (strain B4264) GN=glyA PE=3 SV=1 44 450 1.0E-107
sp|Q086C9|GLYA_SHEFN Serine hydroxymethyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=glyA PE=3 SV=1 49 453 1.0E-107
sp|A8FIC1|GLYA_BACP2 Serine hydroxymethyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=glyA PE=3 SV=1 44 482 2.0E-107
sp|A4Y966|GLYA_SHEPC Serine hydroxymethyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=glyA PE=3 SV=1 49 453 2.0E-107
sp|B8E6W1|GLYA_SHEB2 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS223) GN=glyA PE=3 SV=1 49 453 2.0E-107
sp|A3D7D0|GLYA_SHEB5 Serine hydroxymethyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glyA PE=3 SV=1 49 453 2.0E-107
sp|A6TQQ1|GLYA_ALKMQ Serine hydroxymethyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=glyA PE=3 SV=1 45 451 2.0E-107
sp|B1JRX7|GLYA_YERPY Serine hydroxymethyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|Q667X1|GLYA_YERPS Serine hydroxymethyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|A4TMW4|GLYA_YERPP Serine hydroxymethyltransferase OS=Yersinia pestis (strain Pestoides F) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|Q1CKB8|GLYA_YERPN Serine hydroxymethyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|A9R8C1|GLYA_YERPG Serine hydroxymethyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|Q8ZCR1|GLYA_YERPE Serine hydroxymethyltransferase OS=Yersinia pestis GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|B2K9S8|GLYA_YERPB Serine hydroxymethyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|Q1C5G0|GLYA_YERPA Serine hydroxymethyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|Q3K5K9|GLYA3_PSEPF Serine hydroxymethyltransferase 3 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA3 PE=3 SV=1 44 451 2.0E-107
sp|B1XTC3|GLYA_POLNS Serine hydroxymethyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=glyA PE=3 SV=1 45 451 2.0E-107
sp|Q7V335|GLYA_PROMP Serine hydroxymethyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=glyA PE=3 SV=1 44 450 2.0E-107
sp|A7FFW1|GLYA_YERP3 Serine hydroxymethyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glyA PE=3 SV=1 49 451 2.0E-107
sp|Q046F8|GLYA_LACGA Serine hydroxymethyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=glyA PE=3 SV=1 51 450 3.0E-107
sp|B9IRU8|GLYA_BACCQ Serine hydroxymethyltransferase OS=Bacillus cereus (strain Q1) GN=glyA PE=3 SV=1 44 484 3.0E-107
sp|Q72XD7|GLYA_BACC1 Serine hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glyA PE=3 SV=1 44 484 3.0E-107
sp|Q601P7|GLYA_MYCH2 Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain 232) GN=glyA PE=3 SV=1 49 451 3.0E-107
sp|Q74LC1|GLYA_LACJO Serine hydroxymethyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=glyA PE=3 SV=1 51 450 3.0E-107
sp|Q83BT3|GLYA_COXBU Serine hydroxymethyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=glyA PE=3 SV=1 45 451 3.0E-107
sp|A9KBN4|GLYA_COXBN Serine hydroxymethyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=glyA PE=3 SV=1 45 451 3.0E-107
sp|A8G2R8|GLYA_PROM2 Serine hydroxymethyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=glyA PE=3 SV=1 44 471 3.0E-107
sp|Q1LU81|GLYA_BAUCH Serine hydroxymethyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=glyA PE=3 SV=1 49 450 3.0E-107
sp|B0TYH3|GLYA_FRAP2 Serine hydroxymethyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=glyA PE=3 SV=1 45 448 3.0E-107
sp|Q15WB3|GLYA_PSEA6 Serine hydroxymethyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glyA PE=3 SV=1 49 451 3.0E-107
sp|Q1GGA4|GLYA_RUEST Serine hydroxymethyltransferase OS=Ruegeria sp. (strain TM1040) GN=glyA PE=3 SV=1 40 454 3.0E-107
sp|P9WGI9|GLYA1_MYCTU Serine hydroxymethyltransferase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glyA1 PE=1 SV=2 40 474 3.0E-107
sp|Q3KDV1|GLYA1_PSEPF Serine hydroxymethyltransferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=glyA1 PE=3 SV=1 45 450 3.0E-107
sp|Q5FMC0|GLYA_LACAC Serine hydroxymethyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glyA PE=3 SV=1 51 511 3.0E-107
sp|Q630T3|GLYA_BACCZ Serine hydroxymethyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=glyA PE=3 SV=1 44 484 3.0E-107
sp|A6Q478|GLYA_NITSB Serine hydroxymethyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=glyA PE=3 SV=1 45 451 4.0E-107
sp|B1KJJ9|GLYA_SHEWM Serine hydroxymethyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=glyA PE=3 SV=1 49 451 4.0E-107
sp|B0VBB3|GLYA_ACIBY Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AYE) GN=glyA PE=3 SV=1 45 451 4.0E-107
sp|A3M736|GLYA_ACIBT Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=glyA PE=3 SV=2 45 451 4.0E-107
sp|B2HUY9|GLYA_ACIBC Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=glyA PE=3 SV=1 45 451 4.0E-107
sp|B7I2R7|GLYA_ACIB5 Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=glyA PE=3 SV=1 45 451 4.0E-107
sp|B7GZR6|GLYA_ACIB3 Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=glyA PE=3 SV=1 45 451 4.0E-107
sp|P9WGI8|GLYA1_MYCTO Serine hydroxymethyltransferase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glyA1 PE=3 SV=2 40 474 4.0E-107
sp|P59953|GLYA1_MYCBO Serine hydroxymethyltransferase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glyA1 PE=3 SV=2 40 474 4.0E-107
sp|B9KZ44|GLYA_THERP Serine hydroxymethyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=glyA PE=3 SV=1 41 443 4.0E-107
sp|Q9A8J6|GLYA_CAUCR Serine hydroxymethyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=glyA PE=3 SV=1 40 454 5.0E-107
sp|A9N8T8|GLYA_COXBR Serine hydroxymethyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=glyA PE=3 SV=1 45 451 6.0E-107
sp|Q6N693|GLYA1_RHOPA Serine hydroxymethyltransferase 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glyA1 PE=3 SV=1 40 471 6.0E-107
sp|B7IQW9|GLYA_BACC2 Serine hydroxymethyltransferase OS=Bacillus cereus (strain G9842) GN=glyA PE=3 SV=1 44 482 6.0E-107
sp|B7HY76|GLYA_BACC7 Serine hydroxymethyltransferase OS=Bacillus cereus (strain AH187) GN=glyA PE=3 SV=1 44 450 7.0E-107
sp|Q87RR2|GLYA1_VIBPA Serine hydroxymethyltransferase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glyA1 PE=3 SV=1 49 451 8.0E-107
sp|A8GHZ4|GLYA_SERP5 Serine hydroxymethyltransferase OS=Serratia proteamaculans (strain 568) GN=glyA PE=3 SV=1 49 451 9.0E-107
sp|Q814V2|GLYA_BACCR Serine hydroxymethyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glyA PE=3 SV=1 44 450 9.0E-107
sp|C4K1H9|GLYA_RICPU Serine hydroxymethyltransferase OS=Rickettsia peacockii (strain Rustic) GN=glyA PE=3 SV=1 39 451 9.0E-107
sp|B2VI25|GLYA_ERWT9 Serine hydroxymethyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glyA PE=3 SV=1 49 464 1.0E-106
sp|A9VSB4|GLYA_BACWK Serine hydroxymethyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glyA PE=3 SV=1 44 484 1.0E-106
sp|C1CYT8|GLYA_DEIDV Serine hydroxymethyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=glyA PE=3 SV=1 49 454 1.0E-106
sp|A8F2M5|GLYA_RICM5 Serine hydroxymethyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=glyA PE=3 SV=1 39 451 1.0E-106
sp|Q1MS11|GLYA_LAWIP Serine hydroxymethyltransferase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=glyA PE=3 SV=1 59 454 1.0E-106
sp|Q183G0|GLYA_PEPD6 Serine hydroxymethyltransferase OS=Peptoclostridium difficile (strain 630) GN=glyA PE=3 SV=1 44 451 1.0E-106
sp|Q4A8E1|GLYA_MYCH7 Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain 7448) GN=glyA PE=3 SV=1 49 451 1.0E-106
sp|Q3J9K8|GLYA_NITOC Serine hydroxymethyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=glyA PE=3 SV=1 56 451 2.0E-106
sp|B0VLF5|GLYA_ACIBS Serine hydroxymethyltransferase OS=Acinetobacter baumannii (strain SDF) GN=glyA PE=3 SV=1 45 451 2.0E-106
sp|B0TJY5|GLYA_SHEHH Serine hydroxymethyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=glyA PE=3 SV=1 49 451 2.0E-106
sp|B3CM26|GLYA_WOLPP Serine hydroxymethyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=glyA PE=3 SV=1 44 454 2.0E-106
sp|B0S1N3|GLYA_FINM2 Serine hydroxymethyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=glyA PE=3 SV=1 44 450 2.0E-106
sp|B4SJB0|GLYA_STRM5 Serine hydroxymethyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=glyA PE=3 SV=1 45 451 2.0E-106
sp|Q88UT5|GLYA_LACPL Serine hydroxymethyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glyA PE=3 SV=1 46 454 2.0E-106
sp|Q67N41|GLYA_SYMTH Serine hydroxymethyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=glyA PE=3 SV=1 45 454 2.0E-106
sp|Q2RFW7|GLYA_MOOTA Serine hydroxymethyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=glyA PE=3 SV=1 45 455 2.0E-106
sp|Q4AAB2|GLYA_MYCHJ Serine hydroxymethyltransferase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=glyA PE=3 SV=1 49 451 2.0E-106
sp|B8D981|GLYA_BUCA5 Serine hydroxymethyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glyA PE=3 SV=1 45 450 3.0E-106
sp|Q6LU17|GLYA1_PHOPR Serine hydroxymethyltransferase 1 OS=Photobacterium profundum GN=glyA1 PE=3 SV=1 49 451 3.0E-106
sp|A1RHD0|GLYA_SHESW Serine hydroxymethyltransferase OS=Shewanella sp. (strain W3-18-1) GN=glyA PE=3 SV=1 49 453 4.0E-106
sp|Q1MIU5|GLYA_RHIL3 Serine hydroxymethyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=glyA PE=3 SV=1 38 450 4.0E-106
sp|Q6FA66|GLYA_ACIAD Serine hydroxymethyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glyA PE=3 SV=1 45 461 5.0E-106
sp|P57376|GLYA_BUCAI Serine hydroxymethyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glyA PE=3 SV=1 45 450 5.0E-106
sp|B8GG35|GLYA_METPE Serine hydroxymethyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=glyA PE=3 SV=1 43 454 5.0E-106
sp|Q2JT50|GLYA_SYNJA Serine hydroxymethyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=glyA PE=3 SV=1 43 459 5.0E-106
sp|A8GTI9|GLYA_RICRS Serine hydroxymethyltransferase OS=Rickettsia rickettsii (strain Sheila Smith) GN=glyA PE=1 SV=1 39 451 8.0E-106
sp|B0BV27|GLYA_RICRO Serine hydroxymethyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=glyA PE=3 SV=1 39 451 8.0E-106
sp|Q87AS2|GLYA_XYLFT Serine hydroxymethyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glyA PE=3 SV=1 43 471 8.0E-106
sp|B2I8R0|GLYA_XYLF2 Serine hydroxymethyltransferase OS=Xylella fastidiosa (strain M23) GN=glyA PE=3 SV=1 43 471 8.0E-106
sp|A6LBG7|GLYA_PARD8 Serine hydroxymethyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=glyA PE=3 SV=1 47 466 9.0E-106
sp|Q92GH7|GLYA_RICCN Serine hydroxymethyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=glyA PE=3 SV=1 39 451 1.0E-105
sp|C3PLL9|GLYA_RICAE Serine hydroxymethyltransferase OS=Rickettsia africae (strain ESF-5) GN=glyA PE=3 SV=1 39 451 1.0E-105
sp|A8H1Q0|GLYA_SHEPA Serine hydroxymethyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=glyA PE=3 SV=1 49 451 1.0E-105
sp|B9JCX4|GLYA_AGRRK Serine hydroxymethyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=glyA PE=3 SV=1 38 450 1.0E-105
sp|A6X1Y9|GLYA_OCHA4 Serine hydroxymethyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=glyA PE=3 SV=1 40 450 1.0E-105
sp|A8ZTV3|GLYA_DESOH Serine hydroxymethyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=glyA PE=3 SV=1 44 450 1.0E-105
sp|Q7MN19|GLYA1_VIBVY Serine hydroxymethyltransferase 1 OS=Vibrio vulnificus (strain YJ016) GN=glyA1 PE=3 SV=1 49 451 1.0E-105
sp|Q8DFC9|GLYA1_VIBVU Serine hydroxymethyltransferase 1 OS=Vibrio vulnificus (strain CMCP6) GN=glyA1 PE=3 SV=1 49 451 1.0E-105
sp|Q2ST43|GLYA_MYCCT Serine hydroxymethyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=glyA PE=3 SV=1 47 454 1.0E-105
sp|A6Q7H8|GLYA_SULNB Serine hydroxymethyltransferase OS=Sulfurovum sp. (strain NBC37-1) GN=glyA PE=3 SV=1 41 452 1.0E-105
sp|Q11NZ7|GLYA_CYTH3 Serine hydroxymethyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=glyA PE=3 SV=1 49 470 1.0E-105
sp|Q8PPE3|GLYA_XANAC Serine hydroxymethyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glyA PE=3 SV=1 45 451 1.0E-105
sp|Q92QU6|GLYA1_RHIME Serine hydroxymethyltransferase 1 OS=Rhizobium meliloti (strain 1021) GN=glyA1 PE=3 SV=1 40 450 2.0E-105
sp|B3CTZ1|GLYA_ORITI Serine hydroxymethyltransferase OS=Orientia tsutsugamushi (strain Ikeda) GN=glyA PE=3 SV=1 52 511 2.0E-105
sp|B5Y8G6|GLYA_COPPD Serine hydroxymethyltransferase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=glyA PE=3 SV=1 44 448 2.0E-105
sp|Q607U4|GLYA_METCA Serine hydroxymethyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glyA PE=3 SV=1 49 464 2.0E-105
sp|Q6D246|GLYA1_PECAS Serine hydroxymethyltransferase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glyA1 PE=3 SV=1 49 451 2.0E-105
sp|Q2KA25|GLYA_RHIEC Serine hydroxymethyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glyA PE=3 SV=1 38 450 3.0E-105
sp|Q73WG1|GLYA_MYCPA Serine hydroxymethyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glyA PE=3 SV=1 41 455 3.0E-105
sp|B6IZ80|GLYA_COXB2 Serine hydroxymethyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=glyA PE=3 SV=1 45 451 3.0E-105
sp|Q2SFI7|GLYA1_HAHCH Serine hydroxymethyltransferase 1 OS=Hahella chejuensis (strain KCTC 2396) GN=glyA1 PE=3 SV=1 56 450 3.0E-105
sp|A5EVR7|GLYA_DICNV Serine hydroxymethyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=glyA PE=3 SV=1 49 511 3.0E-105
sp|B2J2A2|GLYA_NOSP7 Serine hydroxymethyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=glyA PE=3 SV=1 42 455 4.0E-105
sp|B3ER62|GLYA_AMOA5 Serine hydroxymethyltransferase OS=Amoebophilus asiaticus (strain 5a2) GN=glyA PE=3 SV=1 49 512 4.0E-105
sp|Q5HW65|GLYA_CAMJR Serine hydroxymethyltransferase OS=Campylobacter jejuni (strain RM1221) GN=glyA PE=3 SV=1 45 451 4.0E-105
sp|Q7W1I6|GLYA1_BORPA Serine hydroxymethyltransferase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glyA1 PE=3 SV=1 45 450 4.0E-105
sp|C0R4C7|GLYA_WOLWR Serine hydroxymethyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=glyA PE=3 SV=1 45 454 4.0E-105
sp|Q5V3D7|GLYA_HALMA Serine hydroxymethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=glyA PE=3 SV=1 45 482 4.0E-105
sp|A5CCC4|GLYA_ORITB Serine hydroxymethyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=glyA PE=3 SV=1 52 472 4.0E-105
sp|Q98QM2|GLYA_MYCPU Serine hydroxymethyltransferase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=glyA PE=3 SV=1 49 513 5.0E-105
sp|C4LAE6|GLYA_TOLAT Serine hydroxymethyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=glyA PE=3 SV=1 49 471 5.0E-105
sp|B4UIM7|GLYA_ANASK Serine hydroxymethyltransferase OS=Anaeromyxobacter sp. (strain K) GN=glyA PE=3 SV=1 45 454 5.0E-105
sp|Q7MAR0|GLYA_WOLSU Serine hydroxymethyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=glyA PE=3 SV=1 45 451 5.0E-105
sp|B6JGH9|GLYA_OLICO Serine hydroxymethyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=glyA PE=3 SV=1 40 450 6.0E-105
sp|B0CL90|GLYA_BRUSI Serine hydroxymethyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=glyA PE=3 SV=1 24 450 6.0E-105
sp|Q8G1F1|GLYA_BRUSU Serine hydroxymethyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=glyA PE=3 SV=1 24 450 6.0E-105
sp|A9MAE5|GLYA_BRUC2 Serine hydroxymethyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=glyA PE=3 SV=1 24 450 6.0E-105
sp|A8FKI9|GLYA_CAMJ8 Serine hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=glyA PE=3 SV=1 45 451 6.0E-105
sp|O85718|GLYA_ACIRA Serine hydroxymethyltransferase OS=Acinetobacter radioresistens GN=glyA PE=3 SV=1 49 461 6.0E-105
sp|Q8U7Y5|GLYA2_AGRFC Serine hydroxymethyltransferase 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glyA2 PE=3 SV=1 43 471 7.0E-105
sp|A5FEF4|GLYA_FLAJ1 Serine hydroxymethyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=glyA PE=3 SV=1 49 454 7.0E-105
sp|Q3BXI8|GLYA_XANC5 Serine hydroxymethyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glyA PE=3 SV=1 45 451 7.0E-105
sp|C0RIA2|GLYA_BRUMB Serine hydroxymethyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=glyA PE=3 SV=1 24 450 8.0E-105
sp|B0U4K9|GLYA_XYLFM Serine hydroxymethyltransferase OS=Xylella fastidiosa (strain M12) GN=glyA PE=3 SV=2 43 471 9.0E-105
sp|Q1WTR3|GLYA_LACS1 Serine hydroxymethyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=glyA PE=3 SV=1 45 469 9.0E-105
sp|A0QC23|GLYA_MYCA1 Serine hydroxymethyltransferase OS=Mycobacterium avium (strain 104) GN=glyA PE=3 SV=2 41 455 1.0E-104
sp|Q7WPH6|GLYA1_BORBR Serine hydroxymethyltransferase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glyA1 PE=3 SV=1 45 450 1.0E-104
sp|A9GPH2|GLYA_SORC5 Serine hydroxymethyltransferase OS=Sorangium cellulosum (strain So ce56) GN=glyA PE=3 SV=1 32 477 1.0E-104
sp|Q57DY5|GLYA_BRUAB Serine hydroxymethyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=glyA PE=3 SV=1 24 450 1.0E-104
sp|Q2YN95|GLYA_BRUA2 Serine hydroxymethyltransferase OS=Brucella abortus (strain 2308) GN=glyA PE=3 SV=1 24 450 1.0E-104
sp|B2S513|GLYA_BRUA1 Serine hydroxymethyltransferase OS=Brucella abortus (strain S19) GN=glyA PE=3 SV=1 24 450 1.0E-104
sp|Q8PCN4|GLYA_XANCP Serine hydroxymethyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glyA PE=3 SV=1 45 451 1.0E-104
sp|B0RVE1|GLYA_XANCB Serine hydroxymethyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=glyA PE=3 SV=1 45 451 1.0E-104
sp|Q4UQT6|GLYA_XANC8 Serine hydroxymethyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glyA PE=3 SV=1 45 451 1.0E-104
sp|Q7N216|GLYA_PHOLL Serine hydroxymethyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glyA PE=3 SV=1 49 469 2.0E-104
sp|B8JEW9|GLYA_ANAD2 Serine hydroxymethyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=glyA PE=3 SV=1 45 454 2.0E-104
sp|B8CYJ3|GLYA_HALOH Serine hydroxymethyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=glyA PE=3 SV=1 45 450 2.0E-104
sp|B8CJM7|GLYA_SHEPW Serine hydroxymethyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=glyA PE=3 SV=1 49 451 2.0E-104
sp|B3PN94|GLYA_MYCA5 Serine hydroxymethyltransferase OS=Mycoplasma arthritidis (strain 158L3-1) GN=glyA PE=3 SV=1 49 454 2.0E-104
sp|Q5GW07|GLYA_XANOR Serine hydroxymethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glyA PE=3 SV=1 45 451 2.0E-104
sp|B2SNV6|GLYA_XANOP Serine hydroxymethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=glyA PE=3 SV=1 45 451 2.0E-104
sp|Q2NZ83|GLYA_XANOM Serine hydroxymethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glyA PE=3 SV=1 45 451 2.0E-104
sp|A5VPU7|GLYA_BRUO2 Serine hydroxymethyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=glyA PE=3 SV=1 24 450 3.0E-104
sp|B6EHX0|GLYA_ALISL Serine hydroxymethyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=glyA PE=3 SV=1 49 451 3.0E-104
sp|Q47MD6|GLYA_THEFY Serine hydroxymethyltransferase OS=Thermobifida fusca (strain YX) GN=glyA PE=3 SV=1 34 454 3.0E-104
sp|A7H4X6|GLYA_CAMJD Serine hydroxymethyltransferase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=glyA PE=3 SV=1 45 451 4.0E-104
sp|Q6ADF0|GLYA_LEIXX Serine hydroxymethyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glyA PE=3 SV=1 41 466 4.0E-104
sp|P24531|GLYA_CAMJE Serine hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=glyA PE=1 SV=2 45 451 4.0E-104
sp|Q6CZV5|GLYA2_PECAS Serine hydroxymethyltransferase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glyA2 PE=3 SV=1 42 511 4.0E-104
sp|Q9KTG1|GLYA1_VIBCH Serine hydroxymethyltransferase 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glyA1 PE=3 SV=2 49 451 4.0E-104
sp|Q6MS85|GLYA_MYCMS Serine hydroxymethyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=glyA PE=3 SV=1 54 454 4.0E-104
sp|Q5GTS7|GLYA_WOLTR Serine hydroxymethyltransferase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=glyA PE=3 SV=1 45 454 4.0E-104
sp|Q5LPA8|GLYA_RUEPO Serine hydroxymethyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=glyA1 PE=3 SV=1 40 454 5.0E-104
sp|A1B0I7|GLYA_PARDP Serine hydroxymethyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=glyA PE=3 SV=1 40 451 6.0E-104
sp|A5EKI3|GLYA_BRASB Serine hydroxymethyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=glyA PE=3 SV=1 25 476 7.0E-104
sp|B2S0U9|GLYA_BORHD Serine hydroxymethyltransferase OS=Borrelia hermsii (strain HS1 / DAH) GN=glyA PE=3 SV=1 49 454 7.0E-104
sp|A1SUU0|GLYA_PSYIN Serine hydroxymethyltransferase OS=Psychromonas ingrahamii (strain 37) GN=glyA PE=1 SV=1 49 466 8.0E-104
sp|Q2NAR9|GLYA_ERYLH Serine hydroxymethyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=glyA PE=3 SV=1 45 451 8.0E-104
sp|Q32D21|GLYA_SHIDS Serine hydroxymethyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|Q5HAJ7|GLYA_EHRRW Serine hydroxymethyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=glyA PE=3 SV=1 45 451 1.0E-103
sp|Q5FG30|GLYA_EHRRG Serine hydroxymethyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=glyA PE=3 SV=1 45 451 1.0E-103
sp|P0A827|GLYA_SHIFL Serine hydroxymethyltransferase OS=Shigella flexneri GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|Q0T1W9|GLYA_SHIF8 Serine hydroxymethyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|Q31XT6|GLYA_SHIBS Serine hydroxymethyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B2TXW4|GLYA_SHIB3 Serine hydroxymethyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|Q1R8I4|GLYA_ECOUT Serine hydroxymethyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=glyA PE=3 SV=2 49 451 1.0E-103
sp|B1LNK7|GLYA_ECOSM Serine hydroxymethyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B6I5C4|GLYA_ECOSE Serine hydroxymethyltransferase OS=Escherichia coli (strain SE11) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|P0A825|GLYA_ECOLI Serine hydroxymethyltransferase OS=Escherichia coli (strain K12) GN=glyA PE=1 SV=1 49 451 1.0E-103
sp|B1IVS6|GLYA_ECOLC Serine hydroxymethyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|P0A826|GLYA_ECOL6 Serine hydroxymethyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|Q0TET8|GLYA_ECOL5 Serine hydroxymethyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|A1AE82|GLYA_ECOK1 Serine hydroxymethyltransferase OS=Escherichia coli O1:K1 / APEC GN=glyA PE=3 SV=2 49 451 1.0E-103
sp|A8A359|GLYA_ECOHS Serine hydroxymethyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B1XB26|GLYA_ECODH Serine hydroxymethyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|C4ZXC6|GLYA_ECOBW Serine hydroxymethyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B7M8A7|GLYA_ECO8A Serine hydroxymethyltransferase OS=Escherichia coli O8 (strain IAI1) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B7MYI0|GLYA_ECO81 Serine hydroxymethyltransferase OS=Escherichia coli O81 (strain ED1a) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B7NRK2|GLYA_ECO7I Serine hydroxymethyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B7LDE3|GLYA_ECO55 Serine hydroxymethyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B7MIN5|GLYA_ECO45 Serine hydroxymethyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|B7UGZ1|GLYA_ECO27 Serine hydroxymethyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|A7ZPZ4|GLYA_ECO24 Serine hydroxymethyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glyA PE=3 SV=1 49 451 1.0E-103
sp|Q3YRD1|GLYA_EHRCJ Serine hydroxymethyltransferase OS=Ehrlichia canis (strain Jake) GN=glyA PE=3 SV=1 40 451 1.0E-103
sp|B2GM31|GLYA_KOCRD Serine hydroxymethyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=glyA PE=3 SV=1 45 461 1.0E-103
sp|Q2JI36|GLYA_SYNJB Serine hydroxymethyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=glyA PE=3 SV=1 43 450 1.0E-103
sp|B0SMI6|GLYA_LEPBP Serine hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=glyA PE=3 SV=1 43 450 1.0E-103
sp|B0SEF8|GLYA_LEPBA Serine hydroxymethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=glyA PE=3 SV=1 43 450 1.0E-103
sp|Q8Y1G1|GLYA1_RALSO Serine hydroxymethyltransferase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=glyA1 PE=3 SV=1 45 450 1.0E-103
sp|A1VYC2|GLYA_CAMJJ Serine hydroxymethyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=glyA PE=3 SV=1 45 451 1.0E-103
sp|Q8YGG7|GLYA_BRUME Serine hydroxymethyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glyA PE=3 SV=2 24 450 2.0E-103
sp|Q3YZ04|GLYA_SHISS Serine hydroxymethyltransferase OS=Shigella sonnei (strain Ss046) GN=glyA PE=3 SV=1 49 451 2.0E-103
sp|Q1QMB9|GLYA_NITHX Serine hydroxymethyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=glyA PE=3 SV=1 26 484 2.0E-103
sp|B1ZJN1|GLYA_METPB Serine hydroxymethyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=glyA PE=3 SV=1 24 471 2.0E-103
sp|Q3MBD8|GLYA_ANAVT Serine hydroxymethyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glyA PE=3 SV=1 42 450 2.0E-103
sp|Q2ILI1|GLYA_ANADE Serine hydroxymethyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=glyA PE=3 SV=1 45 454 2.0E-103
sp|B5Z123|GLYA_ECO5E Serine hydroxymethyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glyA PE=3 SV=1 49 451 2.0E-103
sp|Q8XA55|GLYA_ECO57 Serine hydroxymethyltransferase OS=Escherichia coli O157:H7 GN=glyA PE=3 SV=1 49 451 2.0E-103
sp|Q7VFL1|GLYA_HELHP Serine hydroxymethyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=glyA PE=3 SV=1 45 451 2.0E-103
sp|Q3IZN2|GLYA_RHOS4 Serine hydroxymethyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=glyA PE=3 SV=1 40 454 2.0E-103
sp|Q73GC3|GLYA_WOLPM Serine hydroxymethyltransferase OS=Wolbachia pipientis wMel GN=glyA PE=3 SV=1 45 454 2.0E-103
sp|Q1IS84|GLYA_KORVE Serine hydroxymethyltransferase OS=Koribacter versatilis (strain Ellin345) GN=glyA PE=3 SV=1 41 446 3.0E-103
sp|A7HDY8|GLYA_ANADF Serine hydroxymethyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=glyA PE=3 SV=1 45 486 3.0E-103
sp|Q9X794|GLYA_MYCLE Serine hydroxymethyltransferase OS=Mycobacterium leprae (strain TN) GN=glyA PE=3 SV=1 41 461 3.0E-103
sp|B8ZSH2|GLYA_MYCLB Serine hydroxymethyltransferase OS=Mycobacterium leprae (strain Br4923) GN=glyA PE=3 SV=1 41 461 3.0E-103
sp|B8DBH0|GLYA_LISMH Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=glyA PE=3 SV=1 44 440 3.0E-103
sp|Q71WN9|GLYA_LISMF Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glyA PE=3 SV=1 44 440 3.0E-103
sp|C1KYV6|GLYA_LISMC Serine hydroxymethyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=glyA PE=3 SV=1 44 440 3.0E-103
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5460
MSPTPALRGTTRALRRAVATLTPAATRAKSSMALDGQQQLLSAHLQKADAAVFEIIENEKRRQKHFINLIPSENF
TSQAVLDALGSIMQNKYSEGYPGARYYGGNEFIDESERLCQRRALEAFDLDPKKWGVNVQALSGAPANLYVFSAL
MNTHDRLMGLDLPHGGHLSHGYQTPSKKISFISKYFETLPYRLDESTGLIDYDMLEKLAMLYRPKIIVAGASAYS
RLIDYNRMRDICDKANAYLLADMAHISGLVAAKVLPSPFPHADIVTTTSHKSLRGPRGALIFYRTGVRRQNPKTK
EDELYNLAGPINASVFPGHQGGPHNHTIAALAVALKQAQSADFHAYQLQVLANAKAFAKRLGEAKGKGGLGYSLV
SGGTDNHLVLADLKPSGIDGGRVERVLELVGVAANKNTVPGDRSALVPGGLRMGTPAMTTRGFSEEDFIRVADVV
DRAVAIACRLDKTVRAAAKDRGDKSPGKLSLFLDHLGTGDNEPEIVQLRSEVEDWVGTYPLPWDSAN*
Coding >Ophun1|5460
ATGTCTCCAACGCCCGCCTTGCGAGGCACGACTCGAGCCCTGCGGCGCGCGGTGGCGACGCTGACACCTGCGGCT
ACGAGGGCCAAGTCGTCGATGGCGCTCGACGGCCAGCAGCAGCTGCTCTCGGCGCACCTTCAGAAAGCCGATGCC
GCAGTCTTTGAAATTATCGAGAATGAGAAACGCAGGCAGAAGCACTTTATCAACCTGATTCCTTCCGAGAACTTT
ACCTCGCAGGCGGTGCTGGATGCCCTTGGAAGCATCATGCAGAACAAGTACTCAGAGGGCTACCCCGGCGCTCGA
TATTATGGAGGCAACGAGTTCATTGACGAGTCGGAGCGCCTTTGCCAACGACGGGCCCTCGAGGCCTTTGATCTG
GATCCCAAGAAATGGGGCGTCAATGTCCAGGCTCTGTCTGGCGCGCCCGCCAACCTCTACGTCTTCTCTGCTCTC
ATGAACACGCACGACCGACTAATGGGGCTCGACCTCCCTCACGGTGGCCATCTATCACACGGATACCAGACGCCG
TCGAAAAAGATTTCCTTTATATCAAAATATTTCGAGACGCTGCCTTACCGTCTGGATGAATCGACCGGGCTCATC
GACTACGACATGCTCGAGAAGCTAGCCATGCTCTACCGTCCCAAGATCATCGTGGCTGGTGCCAGCGCCTACAGC
CGCCTCATCGACTACAATCGCATGCGCGACATCTGCGACAAGGCCAATGCCTACCTCCTGGCCGACATGGCACAC
ATATCAGGCCTCGTAGCAGCAAAGGTGCTACCCAGTCCCTTTCCGCACGCCGACATCGTCACCACCACCAGCCAC
AAGAGCTTACGGGGCCCCCGCGGCGCCCTCATCTTCTACCGGACCGGTGTGCGAAGGCAGAACCCCAAGACCAAA
GAGGACGAGCTGTACAACCTGGCCGGTCCCATCAACGCCTCCGTCTTCCCAGGCCATCAGGGCGGACCTCACAAT
CACACCATCGCGGCTCTCGCCGTGGCTCTCAAGCAGGCGCAATCCGCCGACTTCCACGCCTACCAACTCCAAGTG
CTAGCCAACGCAAAAGCCTTTGCCAAGCGCCTCGGCGAAGCCAAGGGCAAGGGCGGGCTGGGCTACAGCCTCGTC
TCGGGCGGGACAGACAACCACCTGGTGCTCGCCGACCTCAAGCCCAGCGGCATCGACGGCGGCCGCGTCGAGCGC
GTTCTCGAGCTCGTCGGCGTGGCGGCCAACAAGAACACCGTGCCGGGGGATCGATCCGCCCTCGTCCCCGGGGGG
TTACGCATGGGCACGCCCGCCATGACGACGCGTGGCTTCAGCGAAGAAGACTTCATCAGGGTCGCCGATGTGGTT
GACCGCGCCGTCGCCATCGCCTGCCGTCTCGACAAGACGGTCCGAGCCGCGGCCAAGGATCGCGGAGATAAGAGT
CCCGGCAAGCTGAGCCTCTTCCTCGACCATCTCGGCACCGGCGATAACGAGCCTGAGATTGTCCAGCTGCGCAGC
GAGGTCGAGGATTGGGTCGGCACGTATCCCCTGCCATGGGACTCGGCCAACTAA
Transcript >Ophun1|5460
ATGTCTCCAACGCCCGCCTTGCGAGGCACGACTCGAGCCCTGCGGCGCGCGGTGGCGACGCTGACACCTGCGGCT
ACGAGGGCCAAGTCGTCGATGGCGCTCGACGGCCAGCAGCAGCTGCTCTCGGCGCACCTTCAGAAAGCCGATGCC
GCAGTCTTTGAAATTATCGAGAATGAGAAACGCAGGCAGAAGCACTTTATCAACCTGATTCCTTCCGAGAACTTT
ACCTCGCAGGCGGTGCTGGATGCCCTTGGAAGCATCATGCAGAACAAGTACTCAGAGGGCTACCCCGGCGCTCGA
TATTATGGAGGCAACGAGTTCATTGACGAGTCGGAGCGCCTTTGCCAACGACGGGCCCTCGAGGCCTTTGATCTG
GATCCCAAGAAATGGGGCGTCAATGTCCAGGCTCTGTCTGGCGCGCCCGCCAACCTCTACGTCTTCTCTGCTCTC
ATGAACACGCACGACCGACTAATGGGGCTCGACCTCCCTCACGGTGGCCATCTATCACACGGATACCAGACGCCG
TCGAAAAAGATTTCCTTTATATCAAAATATTTCGAGACGCTGCCTTACCGTCTGGATGAATCGACCGGGCTCATC
GACTACGACATGCTCGAGAAGCTAGCCATGCTCTACCGTCCCAAGATCATCGTGGCTGGTGCCAGCGCCTACAGC
CGCCTCATCGACTACAATCGCATGCGCGACATCTGCGACAAGGCCAATGCCTACCTCCTGGCCGACATGGCACAC
ATATCAGGCCTCGTAGCAGCAAAGGTGCTACCCAGTCCCTTTCCGCACGCCGACATCGTCACCACCACCAGCCAC
AAGAGCTTACGGGGCCCCCGCGGCGCCCTCATCTTCTACCGGACCGGTGTGCGAAGGCAGAACCCCAAGACCAAA
GAGGACGAGCTGTACAACCTGGCCGGTCCCATCAACGCCTCCGTCTTCCCAGGCCATCAGGGCGGACCTCACAAT
CACACCATCGCGGCTCTCGCCGTGGCTCTCAAGCAGGCGCAATCCGCCGACTTCCACGCCTACCAACTCCAAGTG
CTAGCCAACGCAAAAGCCTTTGCCAAGCGCCTCGGCGAAGCCAAGGGCAAGGGCGGGCTGGGCTACAGCCTCGTC
TCGGGCGGGACAGACAACCACCTGGTGCTCGCCGACCTCAAGCCCAGCGGCATCGACGGCGGCCGCGTCGAGCGC
GTTCTCGAGCTCGTCGGCGTGGCGGCCAACAAGAACACCGTGCCGGGGGATCGATCCGCCCTCGTCCCCGGGGGG
TTACGCATGGGCACGCCCGCCATGACGACGCGTGGCTTCAGCGAAGAAGACTTCATCAGGGTCGCCGATGTGGTT
GACCGCGCCGTCGCCATCGCCTGCCGTCTCGACAAGACGGTCCGAGCCGCGGCCAAGGATCGCGGAGATAAGAGT
CCCGGCAAGCTGAGCCTCTTCCTCGACCATCTCGGCACCGGCGATAACGAGCCTGAGATTGTCCAGCTGCGCAGC
GAGGTCGAGGATTGGGTCGGCACGTATCCCCTGCCATGGGACTCGGCCAACTAA
Gene >Ophun1|5460
ATGTCTCCAACGCCCGCCTTGCGAGGCACGACTCGAGCCCTGCGGCGCGCGGTGGCGACGCTGACACCTGCGGCT
ACGAGGGCCAAGTCGTCGATGGCGCTCGACGGCCAGCAGCAGCTGCTCTCGGCGCACCTTCAGAAAGCCGATGCC
GCAGTCTTTGAAATTATCGAGAATGTGTGTGTGTTCTGCCGTGGAGCTGGCGTGGGCGGCGGGTGCTGAATGGGG
TGCGCAGGAGAAACGCAGGCAGAAGCACTTTATCAACCTGATTCCTTCCGAGAACTTTACCTCGCAGGCGGTGCT
GGATGCCCTTGGAAGCATCATGCAGAGTGAGACTTGTTATCTATCTCTCTAAAACGGCGTGTGCTAACGATGCCT
AGACAAGTACTCAGAGGGCTACCCCGGCGCTCGATATTATGGAGGCAACGAGTTCATTGACGAGTCGGAGCGCCT
TTGCCAACGACGGGCCCTCGAGGCCTTTGATCTGGATCCCAAGAAATGGGGCGTCAATGTCCAGGGTGAGTCTCC
TTTGACCGTTTCGAGGGGGGACAGACTCCTGACCATCATCAGCTCTGTCTGGCGCGCCCGCCAACCTCTACGTCT
TCTCTGCTCTCATGAACACGCACGACCGACTAATGGGGCTCGACCTCCCTCACGGTGGCCATCTATCACACGGAT
ACCAGACGCCGTCGAAAAAGATTTCCTTTATATCAAAATATTTCGAGACGCTGCCTTACCGTCTGGATGAATCGA
CCGGGCTCATCGACTACGACATGCTCGAGAAGCTAGCCATGCTCTACCGTCCCAAGATCATCGTGGCTGGTGCCA
GCGCCTACAGCCGCCTCATCGACTACAATCGCATGCGCGACATCTGCGACAAGGCCAATGCCTACCTCCTGGCCG
ACATGGCACACATATCAGGCCTCGTAGCAGCAAAGGTGCTACCCAGTCCCTTTCCGCACGCCGACATCGTCACCA
CCACCAGCCACAAGAGCTTACGGGGCCCCCGCGGCGCCCTCATCTTCTACCGGACCGGTGTGCGAAGGCAGAACC
CCAAGACCAAAGAGGACGAGCTGTACAACCTGGCCGGTCCCATCAACGCCTCCGTCTTCCCAGGCCATCAGGGCG
GACCTCACAATCACACCATCGCGGCTCTCGCCGTGGCTCTCAAGCAGGCGCAATCCGCCGACTTCCACGCCTACC
AACTCCAAGTGCTAGCCAACGCAAAAGCCTTTGCCAAGCGCCTCGGCGAAGCCAAGGGCAAGGGCGGGCTGGGCT
ACAGCCTCGTCTCGGGCGGGACAGACAACCACCTGGTGCTCGCCGACCTCAAGCCCAGCGGCATCGACGGCGGCC
GCGTCGAGCGCGTTCTCGAGCTCGTCGGCGTGGCGGCCAACAAGAACACCGTGCCGGGGGATCGATCCGCCCTCG
TCCCCGGGGGGTTACGCATGGGCACGCCCGCCATGACGACGCGTGGCTTCAGCGAAGAAGACTTCATCAGGGTCG
CCGATGTGGTTGACCGCGCCGTCGCCATCGCCTGCCGTCTCGACAAGACGGTCCGAGCCGCGGCCAAGGATCGCG
GAGATAAGAGTCCCGGCAAGCTGAGCCTCTTCCTCGACCATCTCGGCACCGGCGATAACGAGCCTGAGATTGTCC
AGCTGCGCAGCGAGGTCGAGGATTGGGTCGGCACGTATCCCCTGCCATGGGACTCGGCCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail