Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5458
Gene name
LocationContig_54:31775..32612
Strand-
Gene length (bp)837
Transcript length (bp)597
Coding sequence length (bp)597
Protein length (aa) 199

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02115 Rho_GDI RHO protein GDP dissociation inhibitor 6.9E-65 11 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14224|GDIR_SCHPO Rho GDP-dissociation inhibitor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F12.06 PE=1 SV=1 22 198 7.0E-51
sp|Q12434|GDIR_YEAST Rho GDP-dissociation inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDI1 PE=1 SV=1 16 196 5.0E-43
sp|Q9TU03|GDIR2_BOVIN Rho GDP-dissociation inhibitor 2 OS=Bos taurus GN=ARHGDIB PE=2 SV=3 5 198 2.0E-39
sp|Q95UQ1|GDIR1_DICDI Putative rho GDP-dissociation inhibitor 1 OS=Dictyostelium discoideum GN=rdiA PE=1 SV=1 24 198 5.0E-39
sp|Q61599|GDIR2_MOUSE Rho GDP-dissociation inhibitor 2 OS=Mus musculus GN=Arhgdib PE=1 SV=3 11 198 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14224|GDIR_SCHPO Rho GDP-dissociation inhibitor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F12.06 PE=1 SV=1 22 198 7.0E-51
sp|Q12434|GDIR_YEAST Rho GDP-dissociation inhibitor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDI1 PE=1 SV=1 16 196 5.0E-43
sp|Q9TU03|GDIR2_BOVIN Rho GDP-dissociation inhibitor 2 OS=Bos taurus GN=ARHGDIB PE=2 SV=3 5 198 2.0E-39
sp|Q95UQ1|GDIR1_DICDI Putative rho GDP-dissociation inhibitor 1 OS=Dictyostelium discoideum GN=rdiA PE=1 SV=1 24 198 5.0E-39
sp|Q61599|GDIR2_MOUSE Rho GDP-dissociation inhibitor 2 OS=Mus musculus GN=Arhgdib PE=1 SV=3 11 198 2.0E-38
sp|P52566|GDIR2_HUMAN Rho GDP-dissociation inhibitor 2 OS=Homo sapiens GN=ARHGDIB PE=1 SV=3 14 198 2.0E-37
sp|Q5XI73|GDIR1_RAT Rho GDP-dissociation inhibitor 1 OS=Rattus norvegicus GN=Arhgdia PE=1 SV=1 22 198 7.0E-37
sp|Q99PT1|GDIR1_MOUSE Rho GDP-dissociation inhibitor 1 OS=Mus musculus GN=Arhgdia PE=1 SV=3 22 198 7.0E-37
sp|Q4R4J0|GDIR1_MACFA Rho GDP-dissociation inhibitor 1 OS=Macaca fascicularis GN=ARHGDIA PE=2 SV=1 22 198 2.0E-36
sp|P19803|GDIR1_BOVIN Rho GDP-dissociation inhibitor 1 OS=Bos taurus GN=ARHGDIA PE=1 SV=3 22 198 2.0E-36
sp|P52565|GDIR1_HUMAN Rho GDP-dissociation inhibitor 1 OS=Homo sapiens GN=ARHGDIA PE=1 SV=3 22 198 2.0E-36
sp|Q9SFC6|GDIR_ARATH Rho GDP-dissociation inhibitor 1 OS=Arabidopsis thaliana GN=GDI1 PE=1 SV=1 21 198 5.0E-34
sp|Q20496|GDIR_CAEEL Probable rho GDP-dissociation inhibitor OS=Caenorhabditis elegans GN=rhi-1 PE=3 SV=1 5 197 4.0E-32
sp|Q99819|GDIR3_HUMAN Rho GDP-dissociation inhibitor 3 OS=Homo sapiens GN=ARHGDIG PE=1 SV=2 7 198 1.0E-31
sp|Q0II80|GDIR3_BOVIN Rho GDP-dissociation inhibitor 3 OS=Bos taurus GN=ARHGDIG PE=2 SV=1 22 198 2.0E-31
sp|Q62160|GDIR3_MOUSE Rho GDP-dissociation inhibitor 3 OS=Mus musculus GN=Arhgdig PE=2 SV=1 7 198 1.0E-30
sp|P80237|GDIR1_CAVPO Rho GDP-dissociation inhibitor 1 (Fragments) OS=Cavia porcellus GN=ARHGDIA PE=1 SV=1 119 196 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005094 Rho GDP-dissociation inhibitor activity Yes
GO:0005737 cytoplasm Yes
GO:0098772 molecular function regulator activity No
GO:0030234 enzyme regulator activity No
GO:0005092 GDP-dissociation inhibitor activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0030695 GTPase regulator activity No
GO:0110165 cellular anatomical entity No
GO:0060589 nucleoside-triphosphatase regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5458
MATYDEDTMPDETLGYKLSQPKHSLAEYQQMDANDESLQRYKESLGLGADKDISDPSDPRVCIILSLTMESPGRD
AATIDLSQPGSERSLKDHPFKIKEGAKFTMSATFKVQHEILSGLHYVQVVKRKGIKVSKDSEMIGSYAPNTVKQT
TYTKKFQEEEAPSGMLARGHYNAVSSFVDDDKKKHLEFEWSFDIAKDW*
Coding >Ophun1|5458
ATGGCCACCTACGACGAGGATACCATGCCCGACGAGACGCTGGGCTACAAGCTCTCGCAGCCCAAGCACAGCTTG
GCTGAATACCAGCAGATGGACGCCAACGACGAGTCCCTTCAGCGATACAAGGAGTCACTCGGTCTCGGCGCCGAC
AAGGACATCTCAGACCCCAGCGACCCTCGTGTCTGCATCATTCTCTCCCTGACCATGGAGTCCCCCGGCCGCGAT
GCCGCAACCATCGATCTATCCCAGCCCGGCAGCGAGCGATCGCTCAAGGACCACCCCTTCAAGATCAAGGAGGGC
GCCAAGTTCACCATGAGCGCCACATTCAAGGTCCAGCACGAGATTCTCAGCGGGCTGCACTACGTCCAGGTGGTC
AAGCGCAAGGGCATCAAAGTCTCCAAGGACTCGGAGATGATTGGAAGCTATGCCCCTAACACGGTCAAGCAGACC
ACATACACCAAGAAATTCCAAGAAGAAGAGGCTCCGTCTGGCATGCTGGCCCGTGGCCACTACAACGCCGTGTCG
AGCTTCGTTGACGACGATAAGAAGAAGCATCTCGAGTTCGAGTGGAGCTTCGACATTGCCAAGGACTGGTGA
Transcript >Ophun1|5458
ATGGCCACCTACGACGAGGATACCATGCCCGACGAGACGCTGGGCTACAAGCTCTCGCAGCCCAAGCACAGCTTG
GCTGAATACCAGCAGATGGACGCCAACGACGAGTCCCTTCAGCGATACAAGGAGTCACTCGGTCTCGGCGCCGAC
AAGGACATCTCAGACCCCAGCGACCCTCGTGTCTGCATCATTCTCTCCCTGACCATGGAGTCCCCCGGCCGCGAT
GCCGCAACCATCGATCTATCCCAGCCCGGCAGCGAGCGATCGCTCAAGGACCACCCCTTCAAGATCAAGGAGGGC
GCCAAGTTCACCATGAGCGCCACATTCAAGGTCCAGCACGAGATTCTCAGCGGGCTGCACTACGTCCAGGTGGTC
AAGCGCAAGGGCATCAAAGTCTCCAAGGACTCGGAGATGATTGGAAGCTATGCCCCTAACACGGTCAAGCAGACC
ACATACACCAAGAAATTCCAAGAAGAAGAGGCTCCGTCTGGCATGCTGGCCCGTGGCCACTACAACGCCGTGTCG
AGCTTCGTTGACGACGATAAGAAGAAGCATCTCGAGTTCGAGTGGAGCTTCGACATTGCCAAGGACTGGTGA
Gene >Ophun1|5458
ATGGCCACCTACGACGAGGATACCATGCCCGACGAGACGCTGGGCTACAAGCTCTCGCAGCCCAAGCACAGCTTG
GCTGAATACCAGCAGATGGGTGAGTCCTCGCTCGCGTGGAGAGAGGGAGAGTCAGGGAGAGAGAGGGAGAAAGAG
GGGTTTCCAAGGGAGCCATCGTCTTGGCGAGAGCGTTACTTACCTAGATTCAACTAGACGCCAACGACGAGTCCC
TTCAGCGATACAAGGAGTCACTCGGTCTCGGCGCCGACAAGGACATCTCAGACCCCAGCGACCCTCGTGTCTGCA
TCATTCTCTCCCTGACCATGGAGTCCCCCGGCCGCGATGCCGCAACCATCGATCTATCCCAGCCCGGCAGCGAGC
GATCGCTCAAGGACCACCCCTTCAAGATCAAGGAGGGCGCCAAGTTCACCATGAGCGCCACATTCAAGGTCCAGC
ACGAGATTCTCAGCGGGCTGCACTACGTCCAGGTGGTCAAGCGCAAGGGCATCAAAGTCTCCAAGGACTCGGAGA
TGATTGTGAGCCGACCAGAGTTATAGCGTTGTGCCAGGCTGTATGCCACTGCTGACTCCGTCGTCCGCAGGGAAG
CTATGCCCCTAACACGGTCAAGCAGACCACATACACCAAGAAATGTTGCCGCCCCTCTCTATCTGCTCGTCGCCA
GCCGAGGCTAACATTGTCTTCCTACACGCAGTCCAAGAAGAAGAGGCTCCGTCTGGCATGCTGGCCCGTGGCCAC
TACAACGCCGTGTCGAGCTTCGTTGACGACGATAAGAAGAAGCATCTCGAGTTCGAGTGGAGCTTCGACATTGCC
AAGGACTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail