Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5452
Gene name
LocationContig_54:18492..20381
Strand-
Gene length (bp)1889
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-37 67 461

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 18 501 7.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 25 508 6.0E-54
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 2 500 3.0E-43
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 44 500 3.0E-41
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 24 389 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 18 501 7.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 25 508 6.0E-54
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 2 500 3.0E-43
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 44 500 3.0E-41
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 24 389 2.0E-18
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 24 389 2.0E-18
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 81 460 4.0E-18
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 81 460 4.0E-18
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 77 457 1.0E-15
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 77 469 4.0E-15
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 113 413 2.0E-14
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 116 468 2.0E-13
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 116 386 3.0E-13
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 95 360 8.0E-13
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 78 370 9.0E-13
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 39 417 5.0E-11
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 80 373 2.0E-10
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 50 468 4.0E-10
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 77 464 3.0E-09
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 76 371 9.0E-09
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 96 543 1.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 76 375 1.0E-08
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 80 483 3.0E-08
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 77 464 3.0E-08
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 80 356 8.0E-08
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 119 473 1.0E-07
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 80 369 2.0E-07
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 80 369 2.0E-07
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 107 530 2.0E-07
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 109 376 3.0E-07
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 95 404 4.0E-07
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 77 268 5.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 77 268 8.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 77 268 8.0E-07
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 77 268 8.0E-07
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 77 268 8.0E-07
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 77 271 1.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 77 271 1.0E-06
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 39 478 4.0E-06
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 44 293 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 94 113 19
3 120 142 22
4 152 174 22
5 181 203 22
6 213 232 19
7 249 266 17
8 281 303 22
9 324 346 22
10 356 378 22
11 383 402 19
12 412 434 22
13 446 465 19
14 485 507 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5452
MARDPPSNKAQTAMMQSTMESVVPEREASEELPKMIDVERLGRQRPAEFSSTWLEVAFVISMLGALSMADFIIGG
FQVVLPALIKPFDIPSGSQTWPSSVLTLVAGAFLFPLGRLSDMYGGYFIFNGGLVWFTLWTIAAGFTGSFYLLVL
CRAMQGLGAAAFLPAGISLLGRIYRPGPRKNLVFAVYGALAPLGFFLGIIIGGLSQDLLSWRWYFWMGGIITGVC
CVGTILTSPRDYASARRMKVRMDWWGVSTMVPGLMLFIYAVTESPNAPKGWASPQIVTTLVLGVLFLIAAVYVEG
WVATSPLIPSDIFRVKYMKRMLLCLLLSWGVFSMYSFYSNFYIQLILGRSALTTAVWYSPWAVGGIVLSLMSGFI
LHILPGRVLLIMCGLSKVLAVLFFALMPENPNYWAWVFPAMLCEAACVDVLWTVSNVFLTTSLPRHRQGLAGALI
SVTLFLGGALFLAVADVVKEQLRTAGFDLKKQYKGIFWIGVGFAGISLCICFFIRLGQAGCALTLEEKREVDLDI
DDEKDQTRREVRASESDTETVVGVEAGADTDKNKA*
Coding >Ophun1|5452
ATGGCCCGAGACCCGCCAAGCAACAAGGCCCAGACCGCCATGATGCAGTCCACCATGGAGTCTGTCGTCCCGGAG
CGAGAGGCCTCGGAAGAGCTGCCCAAGATGATTGACGTCGAGAGGCTTGGTCGCCAACGGCCAGCCGAGTTCTCG
TCGACATGGCTCGAGGTTGCCTTTGTCATCTCCATGCTGGGGGCCCTCTCAATGGCTGACTTTATCATTGGCGGA
TTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCGTTTGATATCCCGTCGGGCTCCCAGACCTGGCCCTCGAGCGTC
CTGACCCTCGTCGCTGGTGCATTCCTCTTTCCGCTCGGCCGACTGAGTGACATGTACGGCGGCTACTTCATCTTC
AACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCCGCTGGCTTCACCGGGAGCTTCTACCTGCTCGTGCTC
TGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTTCCCGCCGGCATCTCCCTGCTGGGTCGCATCTACCGG
CCCGGTCCTCGCAAGAACCTCGTCTTCGCCGTCTACGGCGCCCTCGCTCCCCTGGGCTTCTTCCTCGGCATCATC
ATCGGCGGCCTGTCCCAGGACCTGCTGTCCTGGAGGTGGTACTTTTGGATGGGAGGCATCATCACCGGTGTCTGC
TGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCCTCAGCCCGCAGGATGAAGGTCCGCATGGACTGGTGG
GGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATCTACGCCGTCACTGAGAGCCCCAACGCGCCCAAGGGA
TGGGCCTCGCCTCAGATCGTCACCACCCTGGTTCTCGGCGTCTTGTTCCTCATCGCCGCTGTCTATGTAGAGGGC
TGGGTCGCCACGTCGCCGCTGATACCGAGCGACATCTTTCGCGTCAAGTACATGAAGAGGATGCTTCTTTGCCTC
TTACTCTCATGGGGCGTCTTTTCCATGTACTCGTTTTACTCTAATTTCTATATTCAGCTGATTCTGGGCCGCTCC
GCTCTCACAACGGCCGTCTGGTACAGTCCCTGGGCCGTCGGTGGAATCGTCTTGTCCCTCATGAGCGGCTTCATC
CTGCACATCCTTCCCGGACGCGTGCTGCTCATCATGTGCGGCCTGTCCAAGGTGCTGGCCGTCTTGTTCTTCGCC
CTGATGCCGGAAAACCCCAACTACTGGGCATGGGTGTTTCCCGCCATGCTGTGCGAGGCTGCATGTGTCGACGTG
CTGTGGACGGTGAGCAACGTCTTCCTCACCACCAGCCTGCCACGCCATCGCCAGGGGCTGGCGGGCGCCCTCATC
AGCGTTACGCTGTTCCTGGGCGGCGCCCTGTTCCTCGCCGTGGCCGACGTGGTCAAGGAGCAGCTCCGGACGGCG
GGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGGATCGGCGTGGGCTTCGCCGGCATCTCGCTCTGCATC
TGCTTCTTCATCCGGCTTGGCCAGGCCGGATGCGCGCTTACTCTGGAGGAGAAGCGGGAGGTCGACCTGGATATC
GACGACGAAAAGGACCAGACCCGAAGGGAGGTCCGGGCAAGCGAGTCCGACACCGAGACGGTCGTCGGCGTCGAG
GCCGGGGCCGACACTGACAAGAACAAGGCTTGA
Transcript >Ophun1|5452
ATGGCCCGAGACCCGCCAAGCAACAAGGCCCAGACCGCCATGATGCAGTCCACCATGGAGTCTGTCGTCCCGGAG
CGAGAGGCCTCGGAAGAGCTGCCCAAGATGATTGACGTCGAGAGGCTTGGTCGCCAACGGCCAGCCGAGTTCTCG
TCGACATGGCTCGAGGTTGCCTTTGTCATCTCCATGCTGGGGGCCCTCTCAATGGCTGACTTTATCATTGGCGGA
TTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCGTTTGATATCCCGTCGGGCTCCCAGACCTGGCCCTCGAGCGTC
CTGACCCTCGTCGCTGGTGCATTCCTCTTTCCGCTCGGCCGACTGAGTGACATGTACGGCGGCTACTTCATCTTC
AACGGCGGCCTGGTATGGTTTACCCTCTGGACCATCGCCGCTGGCTTCACCGGGAGCTTCTACCTGCTCGTGCTC
TGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCTTTCTTCCCGCCGGCATCTCCCTGCTGGGTCGCATCTACCGG
CCCGGTCCTCGCAAGAACCTCGTCTTCGCCGTCTACGGCGCCCTCGCTCCCCTGGGCTTCTTCCTCGGCATCATC
ATCGGCGGCCTGTCCCAGGACCTGCTGTCCTGGAGGTGGTACTTTTGGATGGGAGGCATCATCACCGGTGTCTGC
TGTGTAGGCACCATCCTCACCTCTCCCCGTGACTACGCCTCAGCCCGCAGGATGAAGGTCCGCATGGACTGGTGG
GGAGTGTCGACCATGGTTCCGGGCCTGATGCTCTTCATCTACGCCGTCACTGAGAGCCCCAACGCGCCCAAGGGA
TGGGCCTCGCCTCAGATCGTCACCACCCTGGTTCTCGGCGTCTTGTTCCTCATCGCCGCTGTCTATGTAGAGGGC
TGGGTCGCCACGTCGCCGCTGATACCGAGCGACATCTTTCGCGTCAAGTACATGAAGAGGATGCTTCTTTGCCTC
TTACTCTCATGGGGCGTCTTTTCCATGTACTCGTTTTACTCTAATTTCTATATTCAGCTGATTCTGGGCCGCTCC
GCTCTCACAACGGCCGTCTGGTACAGTCCCTGGGCCGTCGGTGGAATCGTCTTGTCCCTCATGAGCGGCTTCATC
CTGCACATCCTTCCCGGACGCGTGCTGCTCATCATGTGCGGCCTGTCCAAGGTGCTGGCCGTCTTGTTCTTCGCC
CTGATGCCGGAAAACCCCAACTACTGGGCATGGGTGTTTCCCGCCATGCTGTGCGAGGCTGCATGTGTCGACGTG
CTGTGGACGGTGAGCAACGTCTTCCTCACCACCAGCCTGCCACGCCATCGCCAGGGGCTGGCGGGCGCCCTCATC
AGCGTTACGCTGTTCCTGGGCGGCGCCCTGTTCCTCGCCGTGGCCGACGTGGTCAAGGAGCAGCTCCGGACGGCG
GGCTTCGACCTCAAGAAGCAGTACAAGGGCATCTTCTGGATCGGCGTGGGCTTCGCCGGCATCTCGCTCTGCATC
TGCTTCTTCATCCGGCTTGGCCAGGCCGGATGCGCGCTTACTCTGGAGGAGAAGCGGGAGGTCGACCTGGATATC
GACGACGAAAAGGACCAGACCCGAAGGGAGGTCCGGGCAAGCGAGTCCGACACCGAGACGGTCGTCGGCGTCGAG
GCCGGGGCCGACACTGACAAGAACAAGGCTTGA
Gene >Ophun1|5452
ATGGCCCGAGACCCGCCAAGCAACAAGGCCCAGACCGCCATGATGCAGTCCACCATGGAGTCTGTCGTCCCGGAG
CGAGAGGCCTCGGAAGAGCTGCCCAAGATGATTGACGTCGAGAGGCTTGGTCGCCAACGGCCAGCCGAGTTCTCG
TCGACATGGCTCGAGGTTGCCTTTGTCATCTCCATGCTGGGGGCCCTCTCAATGGCTGTGGGTGCCTTGTACATA
CGCTGCTTCTTCAACGCTCGCCTTCTTTCACTTTCACTCACTCTCTCCGACTCCCTCGTGAAGATGGAGCGGCTT
GCTGATCCGCACCGCTCACGCAGGACTTTATCATTGGCGGATTTCAAGTTGTGCTGCCCGCCCTGATCAAGCCGT
TTGATATCCCGTCGGGCTCCCAGACCTGGCCCTCGAGCGTCCTGACCCTCGTCGCTGGTGCATTCCTCTTTCCGC
TCGGCCGACTGAGTGACATGTACGGCGGCTACTTCATCTTCAACGGCGGCCTGGTATGGTTTACCCTCTGGACCA
TCGCCGCTGGCTTCACCGGGAGCTTCTACCTGCTCGTGCTCTGCCGCGCCATGCAGGGCCTGGGCGCCGCCGCCT
TTCTTCCCGCCGGCATCTCCCTGCTGGGTCGCATCTACCGGCCCGGTCCTCGCAAGAACCTCGTCTTCGCCGTCT
ACGGCGCCCTCGCTCCCCTGGGCTTCTTCCTCGGCATCATCATCGGCGGCCTGTCCCAGGACCTGCTGTCCTGGA
GGTGGTACTTTTGGATGGGAGGCATCATCACCGGTGTCTGCTGTGTAGGCACCATCCTCACCTCTCCCCGTGACT
ACGCCTCAGCCCGCAGGATGAAGGTCCGCATGGACTGGTGGGGAGTGTCGACCATGGTTCCGGGCCTGATGCTCT
TCATCTACGCCGTCACTGAGAGCCCCAACGCGCCCAAGGGATGGGCCTCGCCTCAGATCGTCACCACCCTGGTTC
TCGGCGTCTTGTTCCTCATCGCCGCTGTCTATGTAGAGGGCTGGGTCGCCACGTCGCCGCTGATACCGAGCGACA
TCTTTCGCGTCAAGTACATGAAGAGGATGCTTCTTTGCCTCTTACTCTCATGGGGCGTCTTTTCCATGTACTCGT
TTTACTCTAATTTCTAGTGAGTACCGGAAGAGACAGGGACGGAGAGCGAGAGACACCGAGAGAGAAACGAGTTGA
GAGACAACGAGGCTGACCTTGACACTATTAGTATTCAGCTGATTCTGGGCCGCTCCGCTCTCACAACGGCCGTCT
GGTACAGTCCCTGGGCCGTCGGTGGAATCGTCTTGTCCCTCATGAGCGGCTTCATCCTGCACATCCTTCCCGGAC
GCGTGCTGCTCATCATGTGCGGCCTGTCCAAGGTGCTGGCCGTCTTGTTCTTCGCCCTGATGCCGGAAAACCCCA
ACTACTGGGCATGGGTGTTTCCCGCCATGCTGTGCGAGGCTGCATGTGTCGACGTGCTGTGGACGGTGAGCAACG
TCTTCCTCACCACCAGCCTGCCACGCCATCGCCAGGGGCTGGCGGGCGCCCTCATCAGCGTTACGCTGTTCCTGG
GCGGCGCCCTGTTCCTCGCCGTGGCCGACGTGGTCAAGGAGCAGCTCCGGACGGCGGGCTTCGACCTCAAGAAGC
AGTACAAGGGCATCTTCTGGATCGGCGTGGGCTTCGCCGGCATCTCGCTCTGCATCTGCTTCTTCATCCGGCTTG
GCCAGGCCGGATGCGCGCTTACTCTGGAGGAGAAGCGGGAGGTCGACCTGGATATCGACGACGAAAAGGACCAGA
CCCGAAGGGAGGTCCGGGCAAGCGAGTCCGACACCGAGACGGTCGTCGGCGTCGAGGCCGGGGCCGACACTGACA
AGAACAAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail