Protein ID | Ophun1|5450 |
Gene name | |
Location | Contig_54:14222..15071 |
Strand | - |
Gene length (bp) | 849 |
Transcript length (bp) | 849 |
Coding sequence length (bp) | 849 |
Protein length (aa) | 283 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF13847 | Methyltransf_31 | Methyltransferase domain | 2.0E-28 | 41 | 165 |
PF08241 | Methyltransf_11 | Methyltransferase domain | 9.2E-25 | 47 | 144 |
PF13649 | Methyltransf_25 | Methyltransferase domain | 2.4E-23 | 46 | 141 |
PF01209 | Ubie_methyltran | ubiE/COQ5 methyltransferase family | 5.5E-17 | 41 | 147 |
PF08242 | Methyltransf_12 | Methyltransferase domain | 8.9E-16 | 47 | 142 |
PF13489 | Methyltransf_23 | Methyltransferase domain | 1.0E-14 | 31 | 161 |
PF07021 | MetW | Methionine biosynthesis protein MetW | 3.2E-09 | 38 | 139 |
PF05175 | MTS | Methyltransferase small domain | 3.0E-08 | 32 | 116 |
PF01135 | PCMT | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) | 5.2E-06 | 31 | 102 |
PF02390 | Methyltransf_4 | Putative methyltransferase | 4.1E-06 | 45 | 126 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O13871|YE16_SCHPO | Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 | 3 | 277 | 7.0E-52 |
sp|P20187|YT37_STRFR | Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 | 47 | 234 | 4.0E-17 |
sp|P49016|MENG_LACLA | Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 | 44 | 153 | 2.0E-14 |
sp|Q6MHQ3|UBIE_BDEBA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ubiE PE=3 SV=1 | 45 | 147 | 3.0E-14 |
sp|B8DBZ5|MENG_LISMH | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 | 37 | 145 | 4.0E-14 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O13871|YE16_SCHPO | Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 | 3 | 277 | 7.0E-52 |
sp|P20187|YT37_STRFR | Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 | 47 | 234 | 4.0E-17 |
sp|P49016|MENG_LACLA | Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 | 44 | 153 | 2.0E-14 |
sp|Q6MHQ3|UBIE_BDEBA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ubiE PE=3 SV=1 | 45 | 147 | 3.0E-14 |
sp|B8DBZ5|MENG_LISMH | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 | 37 | 145 | 4.0E-14 |
sp|P67055|MENG_LISMO | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 | 37 | 145 | 4.0E-14 |
sp|Q71Y84|MENG_LISMF | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 | 37 | 145 | 4.0E-14 |
sp|C1KWN1|MENG_LISMC | Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 | 37 | 145 | 4.0E-14 |
sp|P67056|MENG_LISIN | Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 | 37 | 145 | 4.0E-14 |
sp|A0AK43|MENG_LISW6 | Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 | 37 | 145 | 4.0E-14 |
sp|C5D3E5|MENG_GEOSW | Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 | 39 | 154 | 6.0E-14 |
sp|O86169|MENG_GEOSE | Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 | 39 | 153 | 8.0E-14 |
sp|Q74LY0|MENG_LACJO | Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 | 47 | 181 | 1.0E-13 |
sp|B7GHP8|MENG_ANOFW | Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 | 39 | 154 | 1.0E-13 |
sp|Q5KXU0|MENG_GEOKA | Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 | 39 | 153 | 2.0E-13 |
sp|Q2YY85|MENG_STAAB | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 | 40 | 169 | 2.0E-13 |
sp|O31474|YCGJ_BACSU | Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 | 41 | 141 | 3.0E-13 |
sp|P67063|MENG_STAAW | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|A8Z450|MENG_STAAT | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|Q6G992|MENG_STAAS | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|P67062|MENG_STAAN | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 | 40 | 153 | 4.0E-13 |
sp|P67061|MENG_STAAM | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|A6QH20|MENG_STAAE | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|Q5HFV2|MENG_STAAC | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|A5ISZ9|MENG_STAA9 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|A6U1T9|MENG_STAA2 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|A7X2H6|MENG_STAA1 | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 | 40 | 153 | 4.0E-13 |
sp|Q6GGU0|MENG_STAAR | Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 | 40 | 153 | 7.0E-13 |
sp|Q482G8|UBIG_COLP3 | Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 | 43 | 143 | 1.0E-12 |
sp|Q9KCC4|MENG_BACHD | Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 | 47 | 153 | 2.0E-12 |
sp|A7Z627|MENG_BACMF | Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 | 37 | 154 | 3.0E-12 |
sp|A7GN50|MENG_BACCN | Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-12 |
sp|Q8CSH9|MENG_STAES | Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 | 39 | 215 | 5.0E-12 |
sp|Q5HP74|MENG_STAEQ | Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 | 39 | 215 | 5.0E-12 |
sp|A4WW91|UBIG_RHOS5 | Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiG PE=3 SV=1 | 38 | 199 | 5.0E-12 |
sp|Q4L6H3|MENG_STAHJ | Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 | 39 | 153 | 7.0E-12 |
sp|Q02PX7|UBIG_PSEAB | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiG PE=3 SV=1 | 45 | 215 | 1.0E-11 |
sp|Q9P3R1|ERG6_NEUCR | Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 | 40 | 147 | 2.0E-11 |
sp|A1TSA0|UBIG_ACIAC | Ubiquinone biosynthesis O-methyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ubiG PE=3 SV=1 | 42 | 141 | 2.0E-11 |
sp|A3PNM3|UBIG_RHOS1 | Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiG PE=3 SV=1 | 38 | 199 | 2.0E-11 |
sp|Q9HZ63|UBIG_PSEAE | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiG PE=3 SV=1 | 45 | 215 | 3.0E-11 |
sp|B7V9J5|UBIG_PSEA8 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiG PE=3 SV=1 | 45 | 215 | 3.0E-11 |
sp|Q3IYM5|UBIG_RHOS4 | Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiG PE=3 SV=1 | 38 | 199 | 3.0E-11 |
sp|A9VMC2|MENG_BACWK | Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|Q6HL42|MENG_BACHK | Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|Q63DL9|MENG_BACCZ | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|B9IVN5|MENG_BACCQ | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|B7HL23|MENG_BACC7 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|C1EN10|MENG_BACC3 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|B7JGZ8|MENG_BACC0 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|Q81SW0|MENG_BACAN | Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|C3L8S6|MENG_BACAC | Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|C3P5A0|MENG_BACAA | Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 | 45 | 154 | 3.0E-11 |
sp|B9DNV5|MENG_STACT | Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 | 9 | 153 | 4.0E-11 |
sp|Q81FQ6|MENG_BACCR | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 | 47 | 154 | 4.0E-11 |
sp|B7HHR7|MENG_BACC4 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 | 47 | 154 | 4.0E-11 |
sp|B7IP91|MENG_BACC2 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 | 47 | 154 | 4.0E-11 |
sp|Q21UL3|UBIG_RHOFT | Ubiquinone biosynthesis O-methyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-11 |
sp|Q8CWG0|MENG_OCEIH | Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 | 47 | 154 | 8.0E-11 |
sp|A6V2Q4|UBIG_PSEA7 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiG PE=3 SV=1 | 46 | 215 | 9.0E-11 |
sp|A8FEK9|MENG_BACP2 | Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 | 37 | 154 | 1.0E-10 |
sp|B9KPP7|UBIG_RHOSK | Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiG PE=3 SV=1 | 38 | 199 | 1.0E-10 |
sp|P31113|MENG_BACSU | Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 | 37 | 154 | 1.0E-10 |
sp|Q8KZ94|REBMT_NOCAE | Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 | 37 | 161 | 1.0E-10 |
sp|B2VIL6|UBIG_ERWT9 | Ubiquinone biosynthesis O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiG PE=3 SV=1 | 45 | 168 | 2.0E-10 |
sp|Q9RRT0|MENG_DEIRA | Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 | 45 | 175 | 2.0E-10 |
sp|A7NF26|MENG_ROSCS | Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 | 45 | 199 | 3.0E-10 |
sp|Q5ZT34|BIOC_LEGPH | Malonyl-[acyl-carrier protein] O-methyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=bioC PE=3 SV=2 | 45 | 143 | 3.0E-10 |
sp|Q7WGT9|UBIG_BORBR | Ubiquinone biosynthesis O-methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiG PE=3 SV=2 | 45 | 141 | 3.0E-10 |
sp|Q0AME1|UBIG_MARMM | Ubiquinone biosynthesis O-methyltransferase OS=Maricaulis maris (strain MCS10) GN=ubiG PE=3 SV=1 | 42 | 143 | 3.0E-10 |
sp|Q73AY2|MENG_BACC1 | Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 | 45 | 154 | 4.0E-10 |
sp|Q5WGT4|MENG_BACSK | Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 | 47 | 153 | 4.0E-10 |
sp|Q3K8T6|UBIG_PSEPF | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 | 45 | 215 | 5.0E-10 |
sp|P94298|MENG_BACPE | Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 | 47 | 153 | 6.0E-10 |
sp|Q16D32|UBIG_ROSDO | Ubiquinone biosynthesis O-methyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiG PE=3 SV=1 | 38 | 142 | 6.0E-10 |
sp|Q3BSF8|UBIG_XANC5 | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 | 45 | 201 | 6.0E-10 |
sp|A8GGX8|UBIG_SERP5 | Ubiquinone biosynthesis O-methyltransferase OS=Serratia proteamaculans (strain 568) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|B1JS96|UBIG_YERPY | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|Q66CZ4|UBIG_YERPS | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|A4TNI8|UBIG_YERPP | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|Q1CFZ1|UBIG_YERPN | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|A9R284|UBIG_YERPG | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|Q8ZGR6|UBIG_YERPE | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|B2K9A4|UBIG_YERPB | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|Q1C9H5|UBIG_YERPA | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|A7FKF4|UBIG_YERP3 | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiG PE=3 SV=1 | 43 | 168 | 7.0E-10 |
sp|Q8PK00|UBIG_XANAC | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 | 45 | 201 | 8.0E-10 |
sp|Q1GCH8|UBIG_RUEST | Ubiquinone biosynthesis O-methyltransferase OS=Ruegeria sp. (strain TM1040) GN=ubiG PE=3 SV=1 | 44 | 142 | 8.0E-10 |
sp|O66128|MENG_MICLU | Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 | 39 | 198 | 9.0E-10 |
sp|Q47GP8|UBIG_DECAR | Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 | 45 | 204 | 9.0E-10 |
sp|Q4K8M4|UBIG_PSEF5 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 | 45 | 215 | 1.0E-09 |
sp|B0UPF4|TAM_METS4 | Trans-aconitate 2-methyltransferase OS=Methylobacterium sp. (strain 4-46) GN=tam PE=3 SV=1 | 40 | 149 | 1.0E-09 |
sp|Q7VZG7|UBIG_BORPE | Ubiquinone biosynthesis O-methyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiG PE=3 SV=1 | 45 | 141 | 1.0E-09 |
sp|Q28VP7|UBIG_JANSC | Ubiquinone biosynthesis O-methyltransferase OS=Jannaschia sp. (strain CCS1) GN=ubiG PE=3 SV=1 | 44 | 143 | 1.0E-09 |
sp|Q9JWE6|UBIG_NEIMA | Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiG PE=3 SV=1 | 45 | 143 | 1.0E-09 |
sp|A4SM99|UBIG_AERS4 | Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-09 |
sp|Q6D7X5|UBIG_PECAS | Ubiquinone biosynthesis O-methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiG PE=3 SV=1 | 45 | 168 | 2.0E-09 |
sp|B3H0C8|UBIG_ACTP7 | Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-09 |
sp|Q7W5Z6|UBIG_BORPA | Ubiquinone biosynthesis O-methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ubiG PE=3 SV=2 | 45 | 140 | 2.0E-09 |
sp|Q885T9|UBIG_PSESM | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiG PE=3 SV=2 | 45 | 215 | 2.0E-09 |
sp|Q5P7U3|UBIG_AROAE | Ubiquinone biosynthesis O-methyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-09 |
sp|A9M0C4|UBIG_NEIM0 | Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-09 |
sp|Q5LWM6|UBIG_RUEPO | Ubiquinone biosynthesis O-methyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ubiG PE=3 SV=1 | 44 | 142 | 3.0E-09 |
sp|Q9JXI7|UBIG_NEIMB | Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiG PE=3 SV=2 | 45 | 143 | 3.0E-09 |
sp|Q3SK91|UBIG_THIDA | Ubiquinone biosynthesis O-methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ubiG PE=3 SV=1 | 45 | 141 | 3.0E-09 |
sp|Q0I3Y4|UBIG_HAES1 | Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus somnus (strain 129Pt) GN=ubiG PE=3 SV=1 | 45 | 168 | 4.0E-09 |
sp|C3LLV3|UBIG_VIBCM | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-09 |
sp|Q9KSJ9|UBIG_VIBCH | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-09 |
sp|A5F1U0|UBIG_VIBC3 | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-09 |
sp|Q2NSL7|UBIG_SODGM | Ubiquinone biosynthesis O-methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=ubiG PE=3 SV=1 | 46 | 143 | 5.0E-09 |
sp|Q5GZB5|UBIG_XANOR | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-09 |
sp|B2SHS9|UBIG_XANOP | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-09 |
sp|Q2P2C4|UBIG_XANOM | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-09 |
sp|Q54818|DNRC_STRPE | Aklanonic acid methyltransferase DnrC OS=Streptomyces peucetius GN=dnrC PE=1 SV=1 | 45 | 158 | 5.0E-09 |
sp|B0KTX4|UBIG_PSEPG | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=ubiG PE=3 SV=1 | 45 | 200 | 5.0E-09 |
sp|B7VGS0|UBIG_VIBTL | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=ubiG PE=3 SV=1 | 45 | 143 | 6.0E-09 |
sp|Q88M10|UBIG_PSEPK | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiG PE=3 SV=1 | 45 | 200 | 6.0E-09 |
sp|A5W7G3|UBIG_PSEP1 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiG PE=3 SV=1 | 45 | 200 | 6.0E-09 |
sp|B5FDT8|UBIG_VIBFM | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=ubiG PE=3 SV=1 | 45 | 143 | 6.0E-09 |
sp|Q5E5J8|UBIG_VIBF1 | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ubiG PE=3 SV=1 | 45 | 143 | 6.0E-09 |
sp|C3K6J1|UBIG_PSEFS | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 | 45 | 215 | 7.0E-09 |
sp|B4EZ30|UBIG_PROMH | Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 | 45 | 168 | 7.0E-09 |
sp|Q87ND5|UBIG_VIBPA | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiG PE=3 SV=1 | 45 | 143 | 7.0E-09 |
sp|A7HTX8|UBIG_PARL1 | Ubiquinone biosynthesis O-methyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ubiG PE=3 SV=1 | 42 | 143 | 7.0E-09 |
sp|B0TT38|UBIG_SHEHH | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiG PE=3 SV=1 | 45 | 143 | 7.0E-09 |
sp|A9WRT1|MENG_RENSM | Demethylmenaquinone methyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=menG PE=3 SV=1 | 45 | 153 | 8.0E-09 |
sp|B7UFP4|UBIG_ECO27 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 9.0E-09 |
sp|B1J5G4|UBIG_PSEPW | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain W619) GN=ubiG PE=3 SV=1 | 45 | 200 | 1.0E-08 |
sp|B0UUV6|UBIG_HISS2 | Ubiquinone biosynthesis O-methyltransferase OS=Histophilus somni (strain 2336) GN=ubiG PE=3 SV=1 | 45 | 143 | 1.0E-08 |
sp|Q1IDA6|UBIG_PSEE4 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 | 45 | 200 | 1.0E-08 |
sp|Q49XS5|MENG_STAS1 | Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 | 45 | 152 | 1.0E-08 |
sp|Q65I24|MENG_BACLD | Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 | 47 | 169 | 1.0E-08 |
sp|A1JLA0|UBIG_YERE8 | Ubiquinone biosynthesis O-methyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiG PE=3 SV=1 | 43 | 168 | 1.0E-08 |
sp|Q8P8H2|UBIG_XANCP | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 | 45 | 141 | 1.0E-08 |
sp|B0RS27|UBIG_XANCB | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 | 45 | 141 | 1.0E-08 |
sp|Q4UVL4|UBIG_XANC8 | Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 | 45 | 141 | 1.0E-08 |
sp|Q6ZIX2|SMT1_ORYSJ | Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 | 40 | 147 | 2.0E-08 |
sp|A5UVB2|MENG_ROSS1 | Demethylmenaquinone methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=menG PE=3 SV=1 | 45 | 182 | 2.0E-08 |
sp|A9KGL7|UBIG_COXBN | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 | 46 | 141 | 2.0E-08 |
sp|B6J5Y2|UBIG_COXB1 | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 | 46 | 141 | 2.0E-08 |
sp|Q7N2M5|UBIG_PHOLL | Ubiquinone biosynthesis O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiG PE=3 SV=1 | 45 | 168 | 2.0E-08 |
sp|Q820B5|UBIG_COXBU | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 | 46 | 141 | 2.0E-08 |
sp|A9NBI0|UBIG_COXBR | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 | 46 | 141 | 2.0E-08 |
sp|B6J1W2|UBIG_COXB2 | Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 | 46 | 141 | 2.0E-08 |
sp|A1SE26|MENG_NOCSJ | Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 | 45 | 196 | 2.0E-08 |
sp|Q72HI4|MENG_THET2 | Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 | 45 | 161 | 2.0E-08 |
sp|Q1RJC7|UBIG_RICBR | Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia bellii (strain RML369-C) GN=ubiG PE=3 SV=1 | 43 | 142 | 3.0E-08 |
sp|A8GX11|UBIG_RICB8 | Ubiquinone biosynthesis O-methyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=ubiG PE=3 SV=1 | 43 | 142 | 3.0E-08 |
sp|A8H499|UBIG_SHEPA | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-08 |
sp|Q7VKW2|UBIG_HAEDU | Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-08 |
sp|Q3J8U2|UBIG_NITOC | Ubiquinone biosynthesis O-methyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-08 |
sp|Q96WX4|ERG6_PNECA | Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 | 40 | 147 | 3.0E-08 |
sp|A4JCG7|UBIG_BURVG | Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-08 |
sp|Q5YPB0|MENG_NOCFA | Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 | 40 | 220 | 4.0E-08 |
sp|C6DBN5|UBIG_PECCP | Ubiquinone biosynthesis O-methyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiG PE=3 SV=1 | 45 | 168 | 4.0E-08 |
sp|Q2L2T5|UBIG_BORA1 | Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 | 42 | 141 | 4.0E-08 |
sp|Q6FFY1|UBIG_ACIAD | Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-08 |
sp|C5C0T0|MENG_BEUC1 | Demethylmenaquinone methyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=menG PE=3 SV=1 | 41 | 157 | 4.0E-08 |
sp|Q87TH4|UBIE_VIBPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 | 41 | 165 | 4.0E-08 |
sp|B3QLI9|MENG_CHLP8 | Demethylmenaquinone methyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=menG PE=3 SV=1 | 15 | 178 | 4.0E-08 |
sp|B0U3W1|UBIG_XYLFM | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=ubiG PE=3 SV=1 | 45 | 201 | 4.0E-08 |
sp|A1U3K1|UBIG_MARHV | Ubiquinone biosynthesis O-methyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiG PE=3 SV=1 | 45 | 141 | 4.0E-08 |
sp|B5YX17|UBIG_ECO5E | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|Q8XE29|UBIG_ECO57 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O157:H7 GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|A6TBT7|UBIG_KLEP7 | Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiG PE=3 SV=1 | 45 | 143 | 5.0E-08 |
sp|Q24W96|MENG_DESHY | Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 | 44 | 153 | 5.0E-08 |
sp|Q8FFP0|UBIG_ECOL6 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B1HTA6|MENG_LYSSC | Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 | 45 | 148 | 5.0E-08 |
sp|B8EI29|UBIG_METSB | Ubiquinone biosynthesis O-methyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ubiG PE=3 SV=1 | 38 | 145 | 5.0E-08 |
sp|Q31Z65|UBIG_SHIBS | Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B2TW20|UBIG_SHIB3 | Ubiquinone biosynthesis O-methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B6I7I7|UBIG_ECOSE | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SE11) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B7M5R7|UBIG_ECO8A | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B7LAP9|UBIG_ECO55 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B1IXV6|UBIG_ECOLC | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|Q4ZQ90|UBIG_PSEU2 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiG PE=3 SV=1 | 45 | 200 | 5.0E-08 |
sp|Q48FM4|UBIG_PSE14 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiG PE=3 SV=1 | 45 | 200 | 5.0E-08 |
sp|Q3YZX6|UBIG_SHISS | Ubiquinone biosynthesis O-methyltransferase OS=Shigella sonnei (strain Ss046) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|Q820C5|UBIG_SHIFL | Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|Q0T2P9|UBIG_SHIF8 | Ubiquinone biosynthesis O-methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|Q1R9I4|UBIG_ECOUT | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B7MFZ8|UBIG_ECO45 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|Q0TFL0|UBIG_ECOL5 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|B7MXR3|UBIG_ECO81 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O81 (strain ED1a) GN=ubiG PE=3 SV=1 | 45 | 141 | 5.0E-08 |
sp|Q32DV8|UBIG_SHIDS | Ubiquinone biosynthesis O-methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-08 |
sp|B1LLI3|UBIG_ECOSM | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-08 |
sp|B7N5J4|UBIG_ECOLU | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-08 |
sp|P17993|UBIG_ECOLI | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12) GN=ubiG PE=1 SV=1 | 45 | 141 | 6.0E-08 |
sp|B1X8C6|UBIG_ECODH | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-08 |
sp|C4ZU73|UBIG_ECOBW | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-08 |
sp|A7ZP50|UBIG_ECO24 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-08 |
sp|Q81ZZ2|UBIG_NITEU | Ubiquinone biosynthesis O-methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ubiG PE=3 SV=1 | 46 | 141 | 6.0E-08 |
sp|A8A296|UBIG_ECOHS | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=ubiG PE=3 SV=1 | 45 | 141 | 6.0E-08 |
sp|A8LQ43|UBIG_DINSH | Ubiquinone biosynthesis O-methyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ubiG PE=3 SV=1 | 38 | 143 | 6.0E-08 |
sp|Q7MQ33|UBIE_VIBVY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 | 41 | 165 | 6.0E-08 |
sp|Q8DDP9|UBIE_VIBVU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 | 41 | 165 | 6.0E-08 |
sp|Q5QZ53|UBIG_IDILO | Ubiquinone biosynthesis O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiG PE=3 SV=1 | 45 | 143 | 7.0E-08 |
sp|Q9PAM5|UBIG_XYLFA | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=ubiG PE=3 SV=1 | 45 | 201 | 7.0E-08 |
sp|Q9K3T2|TAM_STRCO | Trans-aconitate 2-methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tam PE=3 SV=1 | 37 | 124 | 7.0E-08 |
sp|Q2NYW4|UBIE_XANOM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiE PE=3 SV=1 | 45 | 168 | 7.0E-08 |
sp|A7MU79|UBIG_VIBCB | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiG PE=3 SV=1 | 45 | 143 | 7.0E-08 |
sp|A7GXW7|CMOB_CAMC5 | tRNA (mo5U34)-methyltransferase OS=Campylobacter curvus (strain 525.92) GN=cmoB PE=3 SV=1 | 36 | 143 | 8.0E-08 |
sp|Q3ILA5|UBIG_PSEHT | Ubiquinone biosynthesis O-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiG PE=3 SV=1 | 43 | 196 | 8.0E-08 |
sp|B2JEZ6|UBIG_BURP8 | Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiG PE=3 SV=1 | 45 | 141 | 8.0E-08 |
sp|A3MZ07|UBIG_ACTP2 | Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 | 45 | 143 | 8.0E-08 |
sp|B5XNZ3|UBIG_KLEP3 | Ubiquinone biosynthesis O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=ubiG PE=3 SV=1 | 45 | 143 | 9.0E-08 |
sp|A7MPA9|UBIG_CROS8 | Ubiquinone biosynthesis O-methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiG PE=3 SV=1 | 45 | 143 | 1.0E-07 |
sp|A4VLX7|UBIG_PSEU5 | Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=ubiG PE=3 SV=1 | 45 | 200 | 1.0E-07 |
sp|B1Y2L3|UBIG_LEPCP | Ubiquinone biosynthesis O-methyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ubiG PE=3 SV=1 | 44 | 143 | 1.0E-07 |
sp|Q87DI1|UBIE_XYLFT | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiE PE=3 SV=1 | 45 | 170 | 1.0E-07 |
sp|B2IA21|UBIE_XYLF2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain M23) GN=ubiE PE=3 SV=1 | 45 | 170 | 1.0E-07 |
sp|B1MHC3|MENG_MYCA9 | Demethylmenaquinone methyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=menG PE=3 SV=1 | 22 | 182 | 1.0E-07 |
sp|Q8PPP2|UBIE_XANAC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiE PE=3 SV=1 | 45 | 170 | 1.0E-07 |
sp|A4XPM7|UBIE_PSEMY | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 | 40 | 147 | 1.0E-07 |
sp|Q31GD8|UBIG_THICR | Ubiquinone biosynthesis O-methyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiG PE=3 SV=1 | 42 | 141 | 1.0E-07 |
sp|Q13VB4|UBIG_BURXL | Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia xenovorans (strain LB400) GN=ubiG PE=3 SV=1 | 46 | 141 | 1.0E-07 |
sp|Q5N4X9|MENG_SYNP6 | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=menG PE=3 SV=1 | 45 | 140 | 1.0E-07 |
sp|Q31P90|MENG_SYNE7 | 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=menG PE=3 SV=1 | 45 | 140 | 1.0E-07 |
sp|Q05197|PMTA_RHOSH | Phosphatidylethanolamine N-methyltransferase OS=Rhodobacter sphaeroides GN=pmtA PE=4 SV=1 | 45 | 144 | 1.0E-07 |
sp|Q6ANL3|UBIE_DESPS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ubiE PE=3 SV=1 | 45 | 188 | 1.0E-07 |
sp|D8MPW4|BIOC_ERWBE | Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia billingiae (strain Eb661) GN=bioC PE=3 SV=1 | 41 | 143 | 1.0E-07 |
sp|Q8P558|UBIE_XANCP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiE PE=3 SV=2 | 45 | 168 | 2.0E-07 |
sp|C1DRQ3|UBIG_AZOVD | Ubiquinone biosynthesis O-methyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiG PE=3 SV=1 | 45 | 200 | 2.0E-07 |
sp|A1RJD1|UBIG_SHESW | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-07 |
sp|Q7NZ91|UBIG_CHRVO | Ubiquinone biosynthesis O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiG PE=3 SV=1 | 45 | 141 | 2.0E-07 |
sp|A4Y759|UBIG_SHEPC | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-07 |
sp|B7LM95|UBIG_ESCF3 | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiG PE=3 SV=1 | 45 | 141 | 2.0E-07 |
sp|Q87BG5|UBIG_XYLFT | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiG PE=3 SV=1 | 45 | 201 | 2.0E-07 |
sp|B2I705|UBIG_XYLF2 | Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=ubiG PE=3 SV=1 | 45 | 201 | 2.0E-07 |
sp|A7MTX1|UBIE_VIBCB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 | 41 | 165 | 2.0E-07 |
sp|B7NN47|UBIG_ECO7I | Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiG PE=3 SV=1 | 45 | 141 | 2.0E-07 |
sp|Q55214|DNRC_STRS5 | Aklanonic acid methyltransferase DauC OS=Streptomyces sp. (strain C5) GN=dauC PE=1 SV=1 | 45 | 158 | 2.0E-07 |
sp|Q2SE61|UBIG_HAHCH | Ubiquinone biosynthesis O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=ubiG PE=3 SV=1 | 45 | 141 | 2.0E-07 |
sp|A1S6C9|UBIG_SHEAM | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-07 |
sp|Q5QYG2|UBIE_IDILO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 | 40 | 147 | 2.0E-07 |
sp|Q1GC56|UBIE_RUEST | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 | 41 | 147 | 2.0E-07 |
sp|C3LPS5|UBIE_VIBCM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 | 41 | 165 | 2.0E-07 |
sp|Q9KVQ6|UBIE_VIBCH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 | 41 | 165 | 2.0E-07 |
sp|A5F4E5|UBIE_VIBC3 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 | 41 | 165 | 2.0E-07 |
sp|Q609G2|UBIG_METCA | Ubiquinone biosynthesis O-methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-07 |
sp|Q6UX53|MET7B_HUMAN | Methyltransferase-like protein 7B OS=Homo sapiens GN=METTL7B PE=1 SV=2 | 46 | 143 | 2.0E-07 |
sp|Q9A9X1|UBIG_CAUCR | Ubiquinone biosynthesis O-methyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ubiG PE=3 SV=1 | 42 | 143 | 3.0E-07 |
sp|B8H209|UBIG_CAUCN | Ubiquinone biosynthesis O-methyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ubiG PE=3 SV=1 | 42 | 143 | 3.0E-07 |
sp|Q2SN12|UBIE_HAHCH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 | 46 | 147 | 3.0E-07 |
sp|Q7MM27|UBIG_VIBVY | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-07 |
sp|Q8D8E0|UBIG_VIBVU | Ubiquinone biosynthesis O-methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-07 |
sp|Q9CMI6|UBIG_PASMU | Ubiquinone biosynthesis O-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-07 |
sp|Q8E9R7|UBIE_SHEON | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 | 41 | 147 | 3.0E-07 |
sp|Q8Y0Z5|UBIG_RALSO | Ubiquinone biosynthesis O-methyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=ubiG PE=3 SV=2 | 45 | 143 | 3.0E-07 |
sp|A8ADY5|UBIG_CITK8 | Ubiquinone biosynthesis O-methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-07 |
sp|A3QIE1|UBIE_SHELP | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 | 41 | 147 | 3.0E-07 |
sp|O14321|ERG6_SCHPO | Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 | 45 | 227 | 3.0E-07 |
sp|Q0HZP7|UBIE_SHESR | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 | 41 | 147 | 4.0E-07 |
sp|Q0HEA1|UBIE_SHESM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 | 41 | 147 | 4.0E-07 |
sp|A0L1M4|UBIE_SHESA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 | 41 | 147 | 4.0E-07 |
sp|B1KR07|UBIE_SHEWM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 | 41 | 147 | 4.0E-07 |
sp|B0V5X4|UBIG_ACIBY | Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AYE) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-07 |
sp|B7IBN2|UBIG_ACIB5 | Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-07 |
sp|B7H2Y9|UBIG_ACIB3 | Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-07 |
sp|C3K8U4|UBIE_PSEFS | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain SBW25) GN=ubiE PE=3 SV=1 | 37 | 147 | 4.0E-07 |
sp|B0U6V1|UBIE_XYLFM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain M12) GN=ubiE PE=3 SV=1 | 45 | 170 | 4.0E-07 |
sp|B0VMN8|UBIG_ACIBS | Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain SDF) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-07 |
sp|Q4ZZG3|UBIE_PSEU2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 | 37 | 147 | 4.0E-07 |
sp|Q48PJ4|UBIE_PSE14 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 | 37 | 147 | 4.0E-07 |
sp|B2I023|UBIG_ACIBC | Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=ubiG PE=3 SV=1 | 45 | 143 | 5.0E-07 |
sp|Q87UZ2|UBIE_PSESM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 | 37 | 147 | 5.0E-07 |
sp|A9L2Y4|UBIG_SHEB9 | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS195) GN=ubiG PE=3 SV=1 | 45 | 143 | 5.0E-07 |
sp|A6WNN7|UBIG_SHEB8 | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS185) GN=ubiG PE=3 SV=1 | 45 | 143 | 5.0E-07 |
sp|A3D499|UBIG_SHEB5 | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiG PE=3 SV=1 | 45 | 143 | 5.0E-07 |
sp|B8EA88|UBIG_SHEB2 | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS223) GN=ubiG PE=3 SV=1 | 45 | 143 | 5.0E-07 |
sp|D2T333|BIOC_ERWP6 | Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=bioC PE=3 SV=1 | 36 | 143 | 5.0E-07 |
sp|B0SW81|UBIG_CAUSK | Ubiquinone biosynthesis O-methyltransferase OS=Caulobacter sp. (strain K31) GN=ubiG PE=3 SV=1 | 42 | 143 | 5.0E-07 |
sp|A8G0S7|UBIE_SHESH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 | 41 | 147 | 5.0E-07 |
sp|A7MQL7|UBIE_CROS8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 | 40 | 165 | 5.0E-07 |
sp|C1DHS2|UBIE_AZOVD | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiE PE=3 SV=1 | 37 | 147 | 6.0E-07 |
sp|Q21IR9|UBIG_SACD2 | Ubiquinone biosynthesis O-methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiG PE=3 SV=1 | 43 | 141 | 6.0E-07 |
sp|Q088H8|UBIE_SHEFN | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 | 41 | 147 | 7.0E-07 |
sp|C6CWS7|BIOC_PAESJ | Malonyl-[acyl-carrier protein] O-methyltransferase OS=Paenibacillus sp. (strain JDR-2) GN=bioC PE=3 SV=1 | 45 | 141 | 7.0E-07 |
sp|B2FUU6|UBIE_STRMK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Stenotrophomonas maltophilia (strain K279a) GN=ubiE PE=3 SV=1 | 45 | 168 | 7.0E-07 |
sp|Q2Y6Z3|UBIG_NITMU | Ubiquinone biosynthesis O-methyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ubiG PE=3 SV=1 | 46 | 141 | 7.0E-07 |
sp|Q9K623|BIOC_BACHD | Malonyl-[acyl-carrier protein] O-methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioC PE=3 SV=1 | 23 | 143 | 8.0E-07 |
sp|A1RP78|UBIE_SHESW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 | 41 | 147 | 8.0E-07 |
sp|A4Y2Q5|UBIE_SHEPC | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 | 41 | 147 | 8.0E-07 |
sp|Q875K1|ERG6_CLAL4 | Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 | 16 | 147 | 8.0E-07 |
sp|A9KYL8|UBIE_SHEB9 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 | 41 | 147 | 8.0E-07 |
sp|A6WIE9|UBIE_SHEB8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 | 41 | 147 | 8.0E-07 |
sp|A3D9F2|UBIE_SHEB5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 | 41 | 147 | 8.0E-07 |
sp|B8E6B6|UBIE_SHEB2 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 | 41 | 147 | 9.0E-07 |
sp|Q9CKD6|UBIE_PASMU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 | 40 | 147 | 9.0E-07 |
sp|Q0HV07|UBIG_SHESR | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain MR-7) GN=ubiG PE=3 SV=1 | 45 | 143 | 9.0E-07 |
sp|B4SJ34|UBIE_STRM5 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Stenotrophomonas maltophilia (strain R551-3) GN=ubiE PE=3 SV=1 | 45 | 168 | 9.0E-07 |
sp|Q82HD9|TAM_STRAW | Trans-aconitate 2-methyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tam PE=3 SV=1 | 37 | 124 | 9.0E-07 |
sp|B2T641|UBIG_BURPP | Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiG PE=3 SV=1 | 46 | 141 | 1.0E-06 |
sp|Q0BHA0|UBIG_BURCM | Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiG PE=3 SV=1 | 45 | 141 | 1.0E-06 |
sp|B1YV26|UBIG_BURA4 | Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=ubiG PE=3 SV=1 | 45 | 141 | 1.0E-06 |
sp|O74198|ERG6_CANAL | Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 | 16 | 147 | 1.0E-06 |
sp|A6VDI6|UBIE_PSEA7 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 | 37 | 147 | 1.0E-06 |
sp|Q0AA73|UBIG_ALKEH | Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 | 45 | 143 | 1.0E-06 |
sp|Q12S23|UBIE_SHEDO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 | 41 | 147 | 1.0E-06 |
sp|A4WCN5|UBIG_ENT38 | Ubiquinone biosynthesis O-methyltransferase OS=Enterobacter sp. (strain 638) GN=ubiG PE=3 SV=1 | 45 | 143 | 1.0E-06 |
sp|A9MJY3|UBIG_SALAR | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiG PE=3 SV=1 | 45 | 143 | 1.0E-06 |
sp|A0KWN3|UBIG_SHESA | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-06 |
sp|Q6C2D9|ERG6_YARLI | Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 | 16 | 147 | 2.0E-06 |
sp|Q9PD92|UBIE_XYLFA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Xylella fastidiosa (strain 9a5c) GN=ubiE PE=3 SV=1 | 45 | 170 | 2.0E-06 |
sp|Q6BRB7|ERG6_DEBHA | Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 | 16 | 147 | 2.0E-06 |
sp|Q9HUC0|UBIE_PSEAE | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 | 37 | 147 | 2.0E-06 |
sp|Q02EV4|UBIE_PSEAB | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 | 37 | 147 | 2.0E-06 |
sp|B7V3F6|UBIE_PSEA8 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 | 37 | 147 | 2.0E-06 |
sp|Q88D17|UBIE_PSEPK | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 | 37 | 147 | 2.0E-06 |
sp|A5WA45|UBIE_PSEP1 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 | 37 | 147 | 2.0E-06 |
sp|Q3KJC5|UBIE_PSEPF | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiE PE=3 SV=1 | 37 | 147 | 2.0E-06 |
sp|Q0HIX5|UBIG_SHESM | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain MR-4) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-06 |
sp|Q8EEG9|UBIG_SHEON | Ubiquinone biosynthesis O-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=ubiG PE=3 SV=1 | 45 | 143 | 2.0E-06 |
sp|Q92SK7|UBIE_RHIME | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium meliloti (strain 1021) GN=ubiE PE=3 SV=2 | 24 | 147 | 2.0E-06 |
sp|A1SAJ8|UBIE_SHEAM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 | 41 | 147 | 2.0E-06 |
sp|Q9FR44|PEAM1_ARATH | Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 | 39 | 150 | 3.0E-06 |
sp|Q9RX93|TAM_DEIRA | Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 | 36 | 146 | 3.0E-06 |
sp|Q9L9F3|NOVO_STRNV | 8-demethylnovobiocic acid C(8)-methyltransferase OS=Streptomyces niveus GN=novO PE=1 SV=2 | 46 | 143 | 3.0E-06 |
sp|Q0BBY4|UBIE_BURCM | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 | 39 | 165 | 3.0E-06 |
sp|B1YWF9|UBIE_BURA4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 | 39 | 165 | 3.0E-06 |
sp|P37431|UBIG_SALTY | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiG PE=3 SV=2 | 45 | 143 | 3.0E-06 |
sp|Q8Z560|UBIG_SALTI | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhi GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-06 |
sp|B4TPG0|UBIG_SALSV | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-06 |
sp|B4SYU8|UBIG_SALNS | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella newport (strain SL254) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-06 |
sp|B4TBE3|UBIG_SALHS | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella heidelberg (strain SL476) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-06 |
sp|B5FNR7|UBIG_SALDC | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-06 |
sp|B5EYW1|UBIG_SALA4 | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella agona (strain SL483) GN=ubiG PE=3 SV=1 | 45 | 143 | 3.0E-06 |
sp|A3PSZ4|Y208_MYCSJ | Uncharacterized methyltransferase Mjls_0208 OS=Mycobacterium sp. (strain JLS) GN=Mjls_0208 PE=3 SV=1 | 46 | 174 | 3.0E-06 |
sp|C3MHQ9|UBIG_RHISN | Ubiquinone biosynthesis O-methyltransferase OS=Rhizobium sp. (strain NGR234) GN=ubiG PE=3 SV=1 | 38 | 143 | 3.0E-06 |
sp|B8CI06|UBIE_SHEPW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 | 41 | 147 | 4.0E-06 |
sp|B0TJ16|UBIE_SHEHH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 | 41 | 147 | 4.0E-06 |
sp|A1KG37|Y605_MYCBP | Uncharacterized protein BCG_0605c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0605c PE=1 SV=1 | 46 | 140 | 4.0E-06 |
sp|A5TZU0|Y567_MYCTA | Uncharacterized protein MRA_0567 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_0567 PE=1 SV=1 | 46 | 140 | 4.0E-06 |
sp|P9WKL5|Y560_MYCTU | Uncharacterized protein Rv0560c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0560c PE=1 SV=1 | 46 | 140 | 4.0E-06 |
sp|P9WKL4|Y560_MYCTO | Uncharacterized protein MT0586 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0586 PE=3 SV=1 | 46 | 140 | 4.0E-06 |
sp|A1U9D7|Y228_MYCSK | Uncharacterized methyltransferase Mkms_0228 OS=Mycobacterium sp. (strain KMS) GN=Mkms_0228 PE=3 SV=1 | 46 | 174 | 4.0E-06 |
sp|Q1BFJ5|Y218_MYCSS | Uncharacterized methyltransferase Mmcs_0218 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_0218 PE=3 SV=1 | 46 | 174 | 4.0E-06 |
sp|A9ADW3|UBIG_BURM1 | Ubiquinone biosynthesis O-methyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiG PE=3 SV=1 | 45 | 141 | 4.0E-06 |
sp|C0Q093|UBIG_SALPC | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-06 |
sp|B5RCA1|UBIG_SALG2 | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-06 |
sp|B5R249|UBIG_SALEP | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiG PE=3 SV=1 | 45 | 143 | 4.0E-06 |
sp|Q57M77|UBIG_SALCH | Ubiquinone biosynthesis O-methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=ubiG PE=3 SV=2 | 45 | 143 | 4.0E-06 |
sp|B1J2S8|UBIE_PSEPW | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain W619) GN=ubiE PE=3 SV=1 | 37 | 147 | 4.0E-06 |
sp|Q1I3T0|UBIE_PSEE4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas entomophila (strain L48) GN=ubiE PE=3 SV=1 | 37 | 147 | 4.0E-06 |
sp|A0KAF5|UBIE_BURCH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 | 39 | 165 | 4.0E-06 |
sp|Q1BTN4|UBIE_BURCA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 | 39 | 165 | 4.0E-06 |
sp|B4EWC9|UBIE_PROMH | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Proteus mirabilis (strain HI4320) GN=ubiE PE=3 SV=1 | 40 | 165 | 4.0E-06 |
sp|B0KM36|UBIE_PSEPG | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain GB-1) GN=ubiE PE=3 SV=1 | 37 | 147 | 4.0E-06 |
sp|Q5X0X6|UBIE_LEGPA | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Paris) GN=ubiE PE=3 SV=1 | 37 | 168 | 4.0E-06 |
sp|B8IJ00|UBIE_METNO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ubiE PE=3 SV=1 | 26 | 141 | 4.0E-06 |
sp|Q9Z5E9|UBIE_PSEOL | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) OS=Pseudomonas oleovorans GN=ubiE PE=3 SV=1 | 37 | 141 | 5.0E-06 |
sp|Q16DL1|UBIE_ROSDO | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiE PE=3 SV=1 | 41 | 147 | 5.0E-06 |
sp|Q9Z439|UBIE_PSEPU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida GN=ubiE PE=3 SV=1 | 37 | 147 | 5.0E-06 |
sp|C5BRL2|UBIE_TERTT | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 | 45 | 147 | 6.0E-06 |
sp|A1T1P0|Y241_MYCVP | Uncharacterized methyltransferase Mvan_0241 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_0241 PE=3 SV=1 | 44 | 213 | 6.0E-06 |
sp|B0UAV0|UBIG_METS4 | Ubiquinone biosynthesis O-methyltransferase OS=Methylobacterium sp. (strain 4-46) GN=ubiG PE=3 SV=1 | 36 | 145 | 6.0E-06 |
sp|B8IUB0|UBIG_METNO | Ubiquinone biosynthesis O-methyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ubiG PE=3 SV=1 | 38 | 145 | 6.0E-06 |
sp|Q1BE01|MENG_MYCSS | Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain MCS) GN=menG PE=3 SV=1 | 45 | 196 | 8.0E-06 |
sp|A1UAY5|MENG_MYCSK | Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain KMS) GN=menG PE=3 SV=1 | 45 | 196 | 8.0E-06 |
sp|A1K8Q1|UBIG_AZOSB | Ubiquinone biosynthesis O-methyltransferase OS=Azoarcus sp. (strain BH72) GN=ubiG PE=3 SV=1 | 45 | 143 | 8.0E-06 |
sp|A1R990|MENG_ARTAT | Demethylmenaquinone methyltransferase OS=Arthrobacter aurescens (strain TC1) GN=menG PE=3 SV=1 | 45 | 156 | 8.0E-06 |
sp|P36566|SMTA_ECOLI | Protein SmtA OS=Escherichia coli (strain K12) GN=smtA PE=1 SV=2 | 42 | 194 | 8.0E-06 |
sp|Q8FUZ3|UBIE_BRUSU | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 | 25 | 141 | 9.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0006400 | tRNA modification | Yes |
GO:0008168 | methyltransferase activity | Yes |
GO:0008176 | tRNA (guanine-N7-)-methyltransferase activity | Yes |
GO:0016740 | transferase activity | No |
GO:0008757 | S-adenosylmethionine-dependent methyltransferase activity | No |
GO:0140098 | catalytic activity, acting on RNA | No |
GO:0090304 | nucleic acid metabolic process | No |
GO:0043170 | macromolecule metabolic process | No |
GO:0006139 | nucleobase-containing compound metabolic process | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:0043412 | macromolecule modification | No |
GO:0140101 | catalytic activity, acting on a tRNA | No |
GO:0016741 | transferase activity, transferring one-carbon groups | No |
GO:0008152 | metabolic process | No |
GO:0140640 | catalytic activity, acting on a nucleic acid | No |
GO:0006396 | RNA processing | No |
GO:0009987 | cellular process | No |
GO:0003824 | catalytic activity | No |
GO:0044238 | primary metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:0016423 | tRNA (guanine) methyltransferase activity | No |
GO:0008033 | tRNA processing | No |
GO:0034660 | ncRNA metabolic process | No |
GO:0003674 | molecular_function | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0046483 | heterocycle metabolic process | No |
GO:0008150 | biological_process | No |
GO:0008173 | RNA methyltransferase activity | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0008175 | tRNA methyltransferase activity | No |
GO:0071704 | organic substance metabolic process | No |
GO:0009451 | RNA modification | No |
GO:0016070 | RNA metabolic process | No |
GO:0006399 | tRNA metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0034470 | ncRNA processing | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 31 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|5450 MPMSRKSESATYTHGHHASVLRSHTWRTAANSAAYLLPHLRQDMRILDVGCGPGTITVDLAGYVPSGHVTGLDRA GRVLDQARAFAAERGLTNVDFAEGDANGLEYADGSFDVVVCHQVLQHVSDPVGVLREMRRVTKSGGLVAARESDY ETMVWHPPVQGMDSWLALYRDVARHNGGEPDAGRMVHAWARRAGFSPDDIASSSSTWCYASAGDVAWWSGLWAER TVESDFAKAAVGAGLATETGLRETAEVWRRWGAQEDAWFSFLHGEVICRKGEVQAVE* |
Coding | >Ophun1|5450 ATGCCCATGAGCCGCAAGTCGGAATCTGCCACTTACACCCACGGCCATCATGCATCCGTCCTCCGGTCTCATACC TGGCGCACTGCCGCCAACTCGGCTGCCTATCTTCTGCCCCATCTGCGGCAAGACATGAGGATTCTCGACGTCGGC TGCGGCCCTGGAACCATCACCGTCGATCTAGCCGGCTACGTGCCGTCGGGTCACGTCACGGGTCTGGACCGCGCA GGCCGGGTGCTCGACCAGGCGCGTGCCTTTGCGGCGGAGCGCGGCCTGACCAACGTCGACTTCGCCGAGGGAGAC GCCAATGGCCTCGAATACGCCGATGGGAGCTTCGATGTCGTCGTCTGCCACCAGGTGCTGCAGCATGTCAGCGAT CCCGTCGGCGTCCTGCGCGAGATGAGGCGCGTGACCAAGTCGGGAGGCCTGGTGGCGGCACGCGAGTCCGACTAC GAAACCATGGTCTGGCATCCGCCCGTCCAGGGCATGGACAGCTGGCTGGCGCTCTACCGGGACGTGGCCAGGCAC AATGGCGGCGAGCCAGATGCCGGCCGTATGGTCCATGCCTGGGCACGAAGGGCCGGCTTCTCGCCCGACGACATC GCCAGCAGCTCCAGCACCTGGTGCTACGCCTCGGCCGGAGACGTCGCCTGGTGGAGCGGGCTGTGGGCCGAGAGG ACGGTGGAATCGGACTTTGCCAAGGCTGCCGTCGGGGCTGGTCTGGCCACCGAGACCGGCCTCCGGGAGACGGCC GAGGTGTGGAGGCGATGGGGGGCGCAGGAGGATGCCTGGTTCTCGTTCCTGCACGGGGAGGTTATCTGCCGCAAG GGAGAGGTGCAGGCGGTTGAATGA |
Transcript | >Ophun1|5450 ATGCCCATGAGCCGCAAGTCGGAATCTGCCACTTACACCCACGGCCATCATGCATCCGTCCTCCGGTCTCATACC TGGCGCACTGCCGCCAACTCGGCTGCCTATCTTCTGCCCCATCTGCGGCAAGACATGAGGATTCTCGACGTCGGC TGCGGCCCTGGAACCATCACCGTCGATCTAGCCGGCTACGTGCCGTCGGGTCACGTCACGGGTCTGGACCGCGCA GGCCGGGTGCTCGACCAGGCGCGTGCCTTTGCGGCGGAGCGCGGCCTGACCAACGTCGACTTCGCCGAGGGAGAC GCCAATGGCCTCGAATACGCCGATGGGAGCTTCGATGTCGTCGTCTGCCACCAGGTGCTGCAGCATGTCAGCGAT CCCGTCGGCGTCCTGCGCGAGATGAGGCGCGTGACCAAGTCGGGAGGCCTGGTGGCGGCACGCGAGTCCGACTAC GAAACCATGGTCTGGCATCCGCCCGTCCAGGGCATGGACAGCTGGCTGGCGCTCTACCGGGACGTGGCCAGGCAC AATGGCGGCGAGCCAGATGCCGGCCGTATGGTCCATGCCTGGGCACGAAGGGCCGGCTTCTCGCCCGACGACATC GCCAGCAGCTCCAGCACCTGGTGCTACGCCTCGGCCGGAGACGTCGCCTGGTGGAGCGGGCTGTGGGCCGAGAGG ACGGTGGAATCGGACTTTGCCAAGGCTGCCGTCGGGGCTGGTCTGGCCACCGAGACCGGCCTCCGGGAGACGGCC GAGGTGTGGAGGCGATGGGGGGCGCAGGAGGATGCCTGGTTCTCGTTCCTGCACGGGGAGGTTATCTGCCGCAAG GGAGAGGTGCAGGCGGTTGAATGA |
Gene | >Ophun1|5450 ATGCCCATGAGCCGCAAGTCGGAATCTGCCACTTACACCCACGGCCATCATGCATCCGTCCTCCGGTCTCATACC TGGCGCACTGCCGCCAACTCGGCTGCCTATCTTCTGCCCCATCTGCGGCAAGACATGAGGATTCTCGACGTCGGC TGCGGCCCTGGAACCATCACCGTCGATCTAGCCGGCTACGTGCCGTCGGGTCACGTCACGGGTCTGGACCGCGCA GGCCGGGTGCTCGACCAGGCGCGTGCCTTTGCGGCGGAGCGCGGCCTGACCAACGTCGACTTCGCCGAGGGAGAC GCCAATGGCCTCGAATACGCCGATGGGAGCTTCGATGTCGTCGTCTGCCACCAGGTGCTGCAGCATGTCAGCGAT CCCGTCGGCGTCCTGCGCGAGATGAGGCGCGTGACCAAGTCGGGAGGCCTGGTGGCGGCACGCGAGTCCGACTAC GAAACCATGGTCTGGCATCCGCCCGTCCAGGGCATGGACAGCTGGCTGGCGCTCTACCGGGACGTGGCCAGGCAC AATGGCGGCGAGCCAGATGCCGGCCGTATGGTCCATGCCTGGGCACGAAGGGCCGGCTTCTCGCCCGACGACATC GCCAGCAGCTCCAGCACCTGGTGCTACGCCTCGGCCGGAGACGTCGCCTGGTGGAGCGGGCTGTGGGCCGAGAGG ACGGTGGAATCGGACTTTGCCAAGGCTGCCGTCGGGGCTGGTCTGGCCACCGAGACCGGCCTCCGGGAGACGGCC GAGGTGTGGAGGCGATGGGGGGCGCAGGAGGATGCCTGGTTCTCGTTCCTGCACGGGGAGGTTATCTGCCGCAAG GGAGAGGTGCAGGCGGTTGAATGA |