Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5447
Gene name
LocationContig_54:6843..8755
Strand-
Gene length (bp)1912
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 5.9E-07 116 164

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5447
MLHRPASLVIAIAALFVIVLPLFYYRLNWDTIRTESIFLRPDGIPDSVHFVYLLEEPDADFPFVFSHYLSVYAAW
YHLKPRRIYLHTDAGAEQITRAREGAAGKWARLILTMPGLTIEKTEAPTVTRTGKEIKEMAHKSDFVRVEVVNRF
GGIYMDFDVFTVGDARPLLRTGFQAVCGREPGGLLSAGVFLAKKRSELTSLWVERMHDVFDGRWVTHSNELMTKI
GRELVPSERRLLVLEEKAFTPVTWKEHGIRELLDEHEDVPSLLGGELPELRHWDQPVPSWAMGFNESNPDNSAML
ITRHVRLLSSLRRTARSYLTMASEKDAPSMESIGVRNSTVNTGPGVTLTAEKKLLVGSVLDLFEGHPSLKHLSLW
QRSATFEDPIAIAKGYDGYAAQWYGLPVLFKPIKIRSHTVTSGGNPMDVSLSNAYTVKGIKSEHVIDSTVRIYVG
DDGKIEKVEDKWNMSTPLVGTSVGDAFRKLSSNTTSKMVKVPKTEEEDRKMQAERGD*
Coding >Ophun1|5447
ATGCTTCACCGGCCGGCTTCACTGGTCATTGCCATCGCCGCCCTGTTCGTTATCGTCCTGCCGTTGTTCTACTAC
CGTCTCAACTGGGATACCATCCGGACCGAGAGCATCTTTCTGCGCCCCGACGGCATCCCCGACTCGGTTCACTTC
GTCTATCTCCTCGAGGAGCCCGACGCCGACTTCCCCTTTGTCTTCTCCCACTATCTCTCCGTCTACGCGGCGTGG
TATCACCTCAAGCCGAGGAGAATCTATCTTCACACCGACGCGGGCGCCGAGCAAATCACCAGGGCCAGAGAGGGA
GCAGCCGGAAAATGGGCGCGGCTGATCCTGACGATGCCCGGCCTGACAATCGAGAAGACTGAGGCTCCGACGGTG
ACGCGGACGGGCAAGGAGATCAAGGAGATGGCGCACAAGTCTGACTTTGTGCGCGTTGAGGTTGTGAATCGCTTC
GGGGGCATCTACATGGACTTTGACGTCTTTACTGTTGGGGATGCGCGGCCGCTGCTGAGGACGGGCTTTCAGGCT
GTCTGCGGTCGTGAACCGGGTGGCCTCTTGTCTGCAGGCGTCTTCCTGGCCAAGAAGCGGAGCGAACTGACGAGT
CTCTGGGTCGAACGGATGCATGACGTCTTTGACGGGCGGTGGGTGACGCACTCAAACGAGTTGATGACCAAGATT
GGCCGTGAACTCGTCCCGTCTGAGAGGAGGCTTCTCGTCCTCGAGGAGAAGGCTTTCACGCCCGTGACGTGGAAA
GAGCACGGGATTCGGGAGCTGCTGGATGAGCATGAGGATGTGCCGTCTTTGTTGGGGGGGGAGCTGCCGGAGCTG
AGACACTGGGATCAGCCGGTTCCGTCGTGGGCTATGGGCTTCAATGAGTCCAATCCTGACAACTCGGCCATGCTC
ATCACCAGACACGTCCGACTGCTCTCTTCTCTGCGACGGACTGCTCGATCGTATCTGACCATGGCTTCGGAAAAG
GACGCGCCGTCGATGGAGTCTATCGGCGTTCGGAACAGCACCGTCAACACGGGGCCCGGCGTGACGCTGACGGCG
GAGAAGAAGCTCCTCGTCGGTTCCGTTCTCGACCTGTTTGAGGGTCACCCTTCGCTTAAACACCTCTCCCTCTGG
CAACGGTCTGCCACGTTTGAGGACCCCATTGCCATCGCAAAGGGCTACGATGGATACGCGGCGCAGTGGTACGGT
CTGCCCGTGCTGTTCAAACCGATCAAGATACGCTCCCATACGGTTACGTCGGGGGGGAACCCGATGGACGTGTCG
CTTAGCAACGCCTATACCGTCAAGGGCATCAAGTCGGAGCACGTCATTGACAGTACCGTCCGCATCTACGTTGGT
GACGACGGGAAGATTGAAAAGGTTGAGGATAAGTGGAATATGAGTACGCCGTTGGTGGGGACGAGCGTCGGCGAT
GCGTTTCGCAAGTTGAGTTCTAATACGACTTCCAAGATGGTCAAGGTTCCGAAGACGGAGGAGGAGGATAGGAAG
ATGCAGGCTGAGAGGGGGGATTAG
Transcript >Ophun1|5447
ATGCTTCACCGGCCGGCTTCACTGGTCATTGCCATCGCCGCCCTGTTCGTTATCGTCCTGCCGTTGTTCTACTAC
CGTCTCAACTGGGATACCATCCGGACCGAGAGCATCTTTCTGCGCCCCGACGGCATCCCCGACTCGGTTCACTTC
GTCTATCTCCTCGAGGAGCCCGACGCCGACTTCCCCTTTGTCTTCTCCCACTATCTCTCCGTCTACGCGGCGTGG
TATCACCTCAAGCCGAGGAGAATCTATCTTCACACCGACGCGGGCGCCGAGCAAATCACCAGGGCCAGAGAGGGA
GCAGCCGGAAAATGGGCGCGGCTGATCCTGACGATGCCCGGCCTGACAATCGAGAAGACTGAGGCTCCGACGGTG
ACGCGGACGGGCAAGGAGATCAAGGAGATGGCGCACAAGTCTGACTTTGTGCGCGTTGAGGTTGTGAATCGCTTC
GGGGGCATCTACATGGACTTTGACGTCTTTACTGTTGGGGATGCGCGGCCGCTGCTGAGGACGGGCTTTCAGGCT
GTCTGCGGTCGTGAACCGGGTGGCCTCTTGTCTGCAGGCGTCTTCCTGGCCAAGAAGCGGAGCGAACTGACGAGT
CTCTGGGTCGAACGGATGCATGACGTCTTTGACGGGCGGTGGGTGACGCACTCAAACGAGTTGATGACCAAGATT
GGCCGTGAACTCGTCCCGTCTGAGAGGAGGCTTCTCGTCCTCGAGGAGAAGGCTTTCACGCCCGTGACGTGGAAA
GAGCACGGGATTCGGGAGCTGCTGGATGAGCATGAGGATGTGCCGTCTTTGTTGGGGGGGGAGCTGCCGGAGCTG
AGACACTGGGATCAGCCGGTTCCGTCGTGGGCTATGGGCTTCAATGAGTCCAATCCTGACAACTCGGCCATGCTC
ATCACCAGACACGTCCGACTGCTCTCTTCTCTGCGACGGACTGCTCGATCGTATCTGACCATGGCTTCGGAAAAG
GACGCGCCGTCGATGGAGTCTATCGGCGTTCGGAACAGCACCGTCAACACGGGGCCCGGCGTGACGCTGACGGCG
GAGAAGAAGCTCCTCGTCGGTTCCGTTCTCGACCTGTTTGAGGGTCACCCTTCGCTTAAACACCTCTCCCTCTGG
CAACGGTCTGCCACGTTTGAGGACCCCATTGCCATCGCAAAGGGCTACGATGGATACGCGGCGCAGTGGTACGGT
CTGCCCGTGCTGTTCAAACCGATCAAGATACGCTCCCATACGGTTACGTCGGGGGGGAACCCGATGGACGTGTCG
CTTAGCAACGCCTATACCGTCAAGGGCATCAAGTCGGAGCACGTCATTGACAGTACCGTCCGCATCTACGTTGGT
GACGACGGGAAGATTGAAAAGGTTGAGGATAAGTGGAATATGAGTACGCCGTTGGTGGGGACGAGCGTCGGCGAT
GCGTTTCGCAAGTTGAGTTCTAATACGACTTCCAAGATGGTCAAGGTTCCGAAGACGGAGGAGGAGGATAGGAAG
ATGCAGGCTGAGAGGGGGGATTAG
Gene >Ophun1|5447
ATGCTTCACCGGCCGGCTTCACTGGTCATTGCCATCGCCGCCCTGTTCGTTATCGTCCTGCCGTTGTTCTACTAC
CGTCTCAACTGGGATACCATCCGGACCGAGAGCATCTTTCTGCGCCCCGACGGCATCCCCGACTCGGTTCACTTC
GTCTATCTCCTCGAGGAGCCCGACGCCGACTTCCCCTTTGTCTTCTCCCACTATCTCTCCGTCTACGCGGCGTGG
TATCACCTCAAGCCGAGGAGAATCTATCTTCACACCGACGCGGGCGCCGAGCAAATCACCAGGGCCAGAGAGGGA
GCAGCCGGAAAATGGGCGCGGCTGATCCTGACGATGCCCGGCCTGACAATCGAGAAGACTGAGGCTCCGACGGTG
ACGCGGACGGGCAAGGAGATCAAGGAGATGGCGCACAAGTCTGACTTTGTGCGCGTTGAGGTTGTGAATCGCTTC
GGGGGCATCTACATGGACTTTGACGTCTTTACTGTTGGGGATGCGCGGCCGCTGCTGAGGACGGGCTTTCAGGCT
GTCTGCGGTCGTGAACCGGGTGGCCTCTTGTCTGCAGGCGTCTTCCTGGCCAAGAAGCGGAGCGAACTGACGAGT
CTCTGGGTCGAACGGATGCATGACGTCTTTGACGGGCGGTGGGTGACGCACTCAAACGAGTTGATGACCAAGATT
GGCCGTGAACTCGTCCCGTCTGAGAGGAGGCTTCTCGTCCTCGAGGAGAAGGCTTTCACGCCCGTGACGTGGAAA
GAGCACGGGATTCGGGAGCTGCTGGATGAGCATGAGGATGTGCCGTCTTTGTTGGGGGGGGAGCTGCCGGAGCTG
AGACACTGGGATCAGCCGGTTCCGTCGTGGGCTATGGGCTTCAATGAGTCGTATTTCATACATGGCTTTCGTGTG
GAAGAGGAGGGGAATGTCGTGACGCCTGCCAAGGTGTTGAGGAGACAGAGTAATATTGGACGGGCAATGTATCCG
GTTGTGCGGGATATGTATGTCCGAGGCATGGTTACGGTCGATGACGAGTGATGATGTATTTGGGTGTATGAGTAT
GATGATGCTAATGTACGTTGCTGCATGGGGGTTAGACAAGACGCGTCATTCATTGTACTGTTAGTGAATATCATC
TTGACTTTCCCCCCCTCATCTAATGAAGCAATCCTGACAACTCGGCCATGCTCATCACCAGACACGTCCGACTGC
TCTCTTCTCTGCGACGGACTGCTCGATCGTATCTGACCATGGCTTCGGAAAAGGACGCGCCGTCGATGGAGTCTA
TCGGCGTTCGGAACAGCACCGTCAACACGGGGCCCGGCGTGACGCTGACGGCGGAGAAGAAGCTCCTCGTCGGTT
CCGTTCTCGACGTCAGTATCGTTGTTGTTTTGTTGGCTTGGGATGGCTCTGACTGGTTTGCTAGCTGTTTGAGGG
TCACCCTTCGCTTAAACACCTCTCCCTCTGGCAACGGTCTGCCACGTTTGAGGACCCCATTGCCATCGCAAAGGG
CTACGATGGATACGCGGCGCAGTGGTACGGTCTGCCCGTGCTGTTCAAACCGATCAAGATACGCTCCCATACGGT
TACGTCGGGGGGGAACCCGATGGACGTGTCGCTTAGCAACGCCTATACCGTCAAGGGCATCAAGTCGGAGCACGT
CATTGACAGTACCGTCCGCATCTACGTTGGTGACGACGGGAAGATTGAAAAGGTTGAGGATAAGTGGAATATGAG
TACGCCGTTGGTGGGGACGAGCGTCGGCGATGTGAGTATGGTGTTGAGAGTAGGTCGTGGGCACGTGTGTTCTGA
CATGGGGCTGCAGGCGTTTCGCAAGTTGAGTTCTAATACGACTTCCAAGATGGTCAAGGTTCCGAAGACGGAGGA
GGAGGATAGGAAGATGCAGGCTGAGAGGGGGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail