Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5445
Gene name
LocationContig_54:3814..5310
Strand-
Gene length (bp)1496
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 8.8E-29 39 158
PF08241 Methyltransf_11 Methyltransferase domain 1.0E-27 44 142
PF13649 Methyltransf_25 Methyltransferase domain 3.2E-26 43 138
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 5.3E-22 16 161
PF13489 Methyltransf_23 Methyltransferase domain 9.2E-19 30 191
PF08242 Methyltransf_12 Methyltransferase domain 7.8E-17 44 139
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.7E-07 30 113
PF02390 Methyltransf_4 Putative methyltransferase 1.8E-07 42 109
PF05175 MTS Methyltransferase small domain 3.2E-07 29 111
PF07021 MetW Methionine biosynthesis protein MetW 2.9E-06 36 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 17 225 2.0E-44
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 9 147 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 17 225 2.0E-44
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 9 147 4.0E-18
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 9 147 1.0E-17
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 38 226 2.0E-17
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 44 149 3.0E-17
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 44 149 3.0E-17
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 44 218 4.0E-17
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 37 215 5.0E-17
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 9 149 6.0E-17
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 44 197 8.0E-17
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 9 149 4.0E-16
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 44 149 6.0E-16
sp|B9DNV5|MENG_STACT Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 44 190 1.0E-15
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 9 149 1.0E-15
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 44 149 2.0E-15
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 44 149 2.0E-15
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 9 189 3.0E-15
sp|Q4L6H3|MENG_STAHJ Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 36 149 3.0E-15
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 41 162 3.0E-15
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 9 149 4.0E-15
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 9 149 4.0E-15
sp|A7GN50|MENG_BACCN Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 9 149 5.0E-15
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 37 147 7.0E-15
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 9 149 8.0E-15
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 9 149 8.0E-15
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 9 149 8.0E-15
sp|Q87TH4|UBIE_VIBPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 38 160 8.0E-15
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 43 142 9.0E-15
sp|A9VMC2|MENG_BACWK Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 9 149 1.0E-14
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 43 144 1.0E-14
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 44 218 2.0E-14
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 9 158 2.0E-14
sp|Q5WGT4|MENG_BACSK Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 9 149 3.0E-14
sp|A7MTX1|UBIE_VIBCB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 38 160 3.0E-14
sp|Q7MQ33|UBIE_VIBVY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 38 160 5.0E-14
sp|Q8DDP9|UBIE_VIBVU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 38 160 5.0E-14
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 44 149 6.0E-14
sp|Q8CWG0|MENG_OCEIH Demethylmenaquinone methyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menG PE=3 SV=1 42 149 8.0E-14
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 9 147 1.0E-13
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 9 188 2.0E-13
sp|C0R2Q3|UBIE_WOLWR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=ubiE PE=3 SV=1 9 196 5.0E-13
sp|Q73HZ4|UBIE_WOLPM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Wolbachia pipientis wMel GN=ubiE PE=3 SV=1 9 196 8.0E-13
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 44 190 1.0E-12
sp|C3LPS5|UBIE_VIBCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 38 160 1.0E-12
sp|Q9KVQ6|UBIE_VIBCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 38 160 1.0E-12
sp|A5F4E5|UBIE_VIBC3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 38 160 1.0E-12
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 9 160 2.0E-12
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 36 192 2.0E-12
sp|A1SRS4|UBIE_PSYIN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Psychromonas ingrahamii (strain 37) GN=ubiE PE=3 SV=1 37 160 3.0E-12
sp|Q24W96|MENG_DESHY Demethylmenaquinone methyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=menG PE=3 SV=1 38 167 4.0E-12
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 19 194 6.0E-12
sp|A7NF26|MENG_ROSCS Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 44 176 6.0E-12
sp|B4EWC9|UBIE_PROMH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Proteus mirabilis (strain HI4320) GN=ubiE PE=3 SV=1 37 160 6.0E-12
sp|B1JP75|UBIE_YERPY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|Q66FT0|UBIE_YERPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|A4TR39|UBIE_YERPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis (strain Pestoides F) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|Q1CNB4|UBIE_YERPN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|A9R431|UBIE_YERPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|Q8D1I3|UBIE_YERPE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|B2K0Y4|UBIE_YERPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|A7FDE0|UBIE_YERP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|A1JIF2|UBIE_YERE8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiE PE=3 SV=1 43 160 7.0E-12
sp|Q6MHQ3|UBIE_BDEBA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ubiE PE=3 SV=1 43 144 8.0E-12
sp|Q1CBG0|UBIE_YERPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiE PE=3 SV=1 43 160 8.0E-12
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 43 156 2.0E-11
sp|A0KAF5|UBIE_BURCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain HI2424) GN=ubiE PE=3 SV=1 36 160 2.0E-11
sp|Q1BTN4|UBIE_BURCA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiE PE=3 SV=1 36 160 2.0E-11
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 38 144 2.0E-11
sp|Q0BBY4|UBIE_BURCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiE PE=3 SV=1 36 160 2.0E-11
sp|B1YWF9|UBIE_BURA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia ambifaria (strain MC40-6) GN=ubiE PE=3 SV=1 36 160 2.0E-11
sp|A8ACY2|UBIE_CITK8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiE PE=3 SV=1 37 160 2.0E-11
sp|P94298|MENG_BACPE Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 9 149 3.0E-11
sp|Q2SN12|UBIE_HAHCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 42 203 3.0E-11
sp|Q9KCC4|MENG_BACHD Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 44 149 3.0E-11
sp|B4EBC4|UBIE_BURCJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 36 160 3.0E-11
sp|B1JYJ6|UBIE_BURCC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 36 160 3.0E-11
sp|A7MQL7|UBIE_CROS8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q3YVD2|UBIE_SHISS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella sonnei (strain Ss046) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|P0A889|UBIE_SHIFL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q0SZ25|UBIE_SHIF8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q32A11|UBIE_SHIDS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q31UF3|UBIE_SHIBS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B2TVI4|UBIE_SHIB3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|A4WFY5|UBIE_ENT38 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Enterobacter sp. (strain 638) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B1LM21|UBIE_ECOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B6I4H5|UBIE_ECOSE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain SE11) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B7NFD6|UBIE_ECOLU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|P0A887|UBIE_ECOLI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12) GN=ubiE PE=1 SV=1 37 160 4.0E-11
sp|B1IW72|UBIE_ECOLC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|A8A6U0|UBIE_ECOHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O9:H4 (strain HS) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B1XAJ7|UBIE_ECODH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / DH10B) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|C5A009|UBIE_ECOBW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B7M638|UBIE_ECO8A Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O8 (strain IAI1) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B7NV33|UBIE_ECO7I Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B5YY82|UBIE_ECO5E Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|P0A888|UBIE_ECO57 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O157:H7 GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B7L996|UBIE_ECO55 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain 55989 / EAEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B7UNG3|UBIE_ECO27 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|A7ZU40|UBIE_ECO24 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q1R477|UBIE_ECOUT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q8FBJ0|UBIE_ECOL6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q0TAM1|UBIE_ECOL5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|A1AI22|UBIE_ECOK1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O1:K1 / APEC GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B7N2E1|UBIE_ECO81 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O81 (strain ED1a) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|B7MHC0|UBIE_ECO45 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiE PE=3 SV=1 37 160 4.0E-11
sp|Q9XAP8|MENG_STRCO Demethylmenaquinone methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=menG PE=3 SV=1 38 194 5.0E-11
sp|Q2T139|UBIE_BURTA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|Q63XA0|UBIE_BURPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain K96243) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|A3N5U8|UBIE_BURP6 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 668) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|Q3JVZ6|UBIE_BURP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1710b) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|A3NRJ4|UBIE_BURP0 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia pseudomallei (strain 1106a) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|A1V753|UBIE_BURMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain SAVP1) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|Q62MP4|UBIE_BURMA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain ATCC 23344) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|A2S8L1|UBIE_BURM9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10229) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|A3MNT8|UBIE_BURM7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia mallei (strain NCTC 10247) GN=ubiE PE=3 SV=1 36 160 8.0E-11
sp|A8G8B8|UBIE_SERP5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Serratia proteamaculans (strain 568) GN=ubiE PE=3 SV=1 43 160 8.0E-11
sp|A9AFC0|UBIE_BURM1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiE PE=3 SV=1 36 160 9.0E-11
sp|B7LU01|UBIE_ESCF3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiE PE=3 SV=1 37 160 1.0E-10
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|Q9HUC0|UBIE_PSEAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiE PE=3 SV=1 43 160 1.0E-10
sp|Q02EV4|UBIE_PSEAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiE PE=3 SV=1 43 160 1.0E-10
sp|B7V3F6|UBIE_PSEA8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiE PE=3 SV=1 43 160 1.0E-10
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|Q8Y278|UBIE_RALSO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia solanacearum (strain GMI1000) GN=ubiE PE=3 SV=1 21 160 1.0E-10
sp|C5C0T0|MENG_BEUC1 Demethylmenaquinone methyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=menG PE=3 SV=1 38 196 1.0E-10
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|A4JHS6|UBIE_BURVG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 36 160 1.0E-10
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|A6VTA1|UBIE_MARMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 43 172 1.0E-10
sp|A8G0S7|UBIE_SHESH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 38 144 1.0E-10
sp|Q8YLP4|MENG_NOSS1 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=menG PE=3 SV=1 38 141 2.0E-10
sp|Q7MZ81|UBIE_PHOLL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiE PE=3 SV=1 43 160 2.0E-10
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 38 147 2.0E-10
sp|Q3MD91|MENG_ANAVT 2-phytyl-1,4-naphtoquinone methyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=menG PE=3 SV=1 38 141 2.0E-10
sp|B2UFG8|UBIE_RALPJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ralstonia pickettii (strain 12J) GN=ubiE PE=3 SV=1 19 160 2.0E-10
sp|A6TGL3|UBIE_KLEP7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|P0A2K5|UBIE_SALTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|P0A2K6|UBIE_SALTI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella typhi GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B4TNX9|UBIE_SALSV Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B5BIX9|UBIE_SALPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|C0Q3E1|UBIE_SALPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi C (strain RKS4594) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|A9MY97|UBIE_SALPB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|Q5PKP4|UBIE_SALPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B4SZ73|UBIE_SALNS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella newport (strain SL254) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B4TBR3|UBIE_SALHS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella heidelberg (strain SL476) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B5RFM8|UBIE_SALG2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B5QW73|UBIE_SALEP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B5FNW6|UBIE_SALDC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella dublin (strain CT_02021853) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|Q57HN8|UBIE_SALCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella choleraesuis (strain SC-B67) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B5EZU8|UBIE_SALA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella agona (strain SL483) GN=ubiE PE=3 SV=1 37 160 2.0E-10
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 38 144 2.0E-10
sp|A9MIY3|UBIE_SALAR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiE PE=3 SV=1 42 160 2.0E-10
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 37 144 3.0E-10
sp|Q39D13|UBIE_BURL3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiE PE=3 SV=1 36 160 3.0E-10
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 38 144 3.0E-10
sp|P46326|YXBB_BACSU Uncharacterized protein YxbB OS=Bacillus subtilis (strain 168) GN=yxbB PE=3 SV=1 42 196 3.0E-10
sp|B5XYI1|UBIE_KLEP3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Klebsiella pneumoniae (strain 342) GN=ubiE PE=3 SV=1 37 160 3.0E-10
sp|Q6ANL3|UBIE_DESPS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ubiE PE=3 SV=1 43 166 4.0E-10
sp|Q9ZCP3|UBIE_RICPR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia prowazekii (strain Madrid E) GN=ubiE PE=3 SV=2 34 148 5.0E-10
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 40 140 6.0E-10
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 34 144 6.0E-10
sp|B2HRQ2|MENG_MYCMM Demethylmenaquinone methyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=menG PE=3 SV=1 90 194 6.0E-10
sp|A1SE26|MENG_NOCSJ Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 87 202 7.0E-10
sp|A0PLV5|MENG_MYCUA Demethylmenaquinone methyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=menG PE=3 SV=1 90 194 8.0E-10
sp|Q8YDE4|UBIE_BRUME Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ubiE PE=3 SV=1 32 215 9.0E-10
sp|C0RMK3|UBIE_BRUMB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ubiE PE=3 SV=1 32 215 9.0E-10
sp|Q576Q0|UBIE_BRUAB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus biovar 1 (strain 9-941) GN=ubiE PE=3 SV=1 32 215 9.0E-10
sp|Q2YJM4|UBIE_BRUA2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain 2308) GN=ubiE PE=3 SV=1 32 215 9.0E-10
sp|B2SC50|UBIE_BRUA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella abortus (strain S19) GN=ubiE PE=3 SV=1 32 215 9.0E-10
sp|A5UVB2|MENG_ROSS1 Demethylmenaquinone methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=menG PE=3 SV=1 44 176 9.0E-10
sp|A3QIE1|UBIE_SHELP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 38 144 1.0E-09
sp|A6WYI0|UBIE_OCHA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 32 215 1.0E-09
sp|A9N9F4|UBIE_COXBR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiE PE=3 SV=1 9 196 1.0E-09
sp|A4VGE5|UBIE_PSEU5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas stutzeri (strain A1501) GN=ubiE PE=3 SV=1 43 160 1.0E-09
sp|Q9CKD6|UBIE_PASMU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pasteurella multocida (strain Pm70) GN=ubiE PE=3 SV=1 43 155 1.0E-09
sp|Q83A90|UBIE_COXBU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiE PE=3 SV=1 9 196 1.0E-09
sp|A9KD75|UBIE_COXBN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiE PE=3 SV=1 9 196 1.0E-09
sp|B6J3P6|UBIE_COXB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiE PE=3 SV=1 9 196 1.0E-09
sp|C6DI77|UBIE_PECCP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiE PE=3 SV=1 37 160 1.0E-09
sp|B0TJ16|UBIE_SHEHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 38 144 1.0E-09
sp|B6J676|UBIE_COXB1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiE PE=3 SV=1 9 196 1.0E-09
sp|O84435|MENG_CHLTR Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=menG PE=3 SV=1 43 181 2.0E-09
sp|Q3KLS2|MENG_CHLTA Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=menG PE=3 SV=1 43 181 2.0E-09
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 21 144 2.0E-09
sp|B2VG41|UBIE_ERWT9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiE PE=3 SV=1 43 160 2.0E-09
sp|B0BC65|MENG_CHLTB Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=menG PE=3 SV=1 43 181 2.0E-09
sp|B0B800|MENG_CHLT2 Demethylmenaquinone methyltransferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=menG PE=3 SV=1 43 181 2.0E-09
sp|A9WRT1|MENG_RENSM Demethylmenaquinone methyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=menG PE=3 SV=1 11 191 2.0E-09
sp|Q8FUZ3|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 32 215 2.0E-09
sp|A6VDI6|UBIE_PSEA7 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas aeruginosa (strain PA7) GN=ubiE PE=3 SV=1 43 144 2.0E-09
sp|Q73SL8|MENG_MYCPA Demethylmenaquinone methyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=menG PE=3 SV=2 46 194 2.0E-09
sp|A3PUJ1|MENG_MYCSJ Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain JLS) GN=menG PE=3 SV=1 46 194 2.0E-09
sp|B2IUM7|MENG_NOSP7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=menG PE=3 SV=1 42 163 2.0E-09
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 32 215 3.0E-09
sp|Q1BE01|MENG_MYCSS Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain MCS) GN=menG PE=3 SV=1 46 194 3.0E-09
sp|A1UAY5|MENG_MYCSK Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain KMS) GN=menG PE=3 SV=1 46 194 3.0E-09
sp|Q68W57|UBIE_RICTY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ubiE PE=3 SV=1 34 144 3.0E-09
sp|Q6DAQ7|UBIE_PECAS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiE PE=3 SV=1 37 160 3.0E-09
sp|Q98GV1|UBIE_RHILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 32 215 3.0E-09
sp|A8H966|UBIE_SHEPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 38 144 3.0E-09
sp|Q4ZZG3|UBIE_PSEU2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 43 160 3.0E-09
sp|Q48PJ4|UBIE_PSE14 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 43 160 3.0E-09
sp|Q87UZ2|UBIE_PSESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 43 160 3.0E-09
sp|B1MHC3|MENG_MYCA9 Demethylmenaquinone methyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=menG PE=3 SV=1 84 194 4.0E-09
sp|A4XPM7|UBIE_PSEMY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas mendocina (strain ymp) GN=ubiE PE=3 SV=1 37 144 4.0E-09
sp|Q9Z439|UBIE_PSEPU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida GN=ubiE PE=3 SV=1 43 160 4.0E-09
sp|Q1I3T0|UBIE_PSEE4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas entomophila (strain L48) GN=ubiE PE=3 SV=1 43 160 4.0E-09
sp|B1J2S8|UBIE_PSEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain W619) GN=ubiE PE=3 SV=1 43 160 4.0E-09
sp|B8CI06|UBIE_SHEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 38 144 4.0E-09
sp|Q475X0|UBIE_CUPPJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ubiE PE=3 SV=1 36 160 4.0E-09
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 37 138 7.0E-09
sp|Q9CBA8|MENG_MYCLE Demethylmenaquinone methyltransferase OS=Mycobacterium leprae (strain TN) GN=menG PE=3 SV=2 90 222 7.0E-09
sp|Q3KJC5|UBIE_PSEPF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiE PE=3 SV=1 43 160 7.0E-09
sp|Q4UMW4|UBIE_RICFE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ubiE PE=3 SV=1 34 144 8.0E-09
sp|A1WVM4|BIOC_HALHL Malonyl-[acyl-carrier protein] O-methyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=bioC PE=3 SV=1 30 196 9.0E-09
sp|A8GPI0|UBIE_RICAH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia akari (strain Hartford) GN=ubiE PE=3 SV=1 43 148 9.0E-09
sp|B0KM36|UBIE_PSEPG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain GB-1) GN=ubiE PE=3 SV=1 43 160 1.0E-08
sp|C1DHS2|UBIE_AZOVD Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiE PE=3 SV=1 43 144 1.0E-08
sp|A8GXR2|UBIE_RICB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia bellii (strain OSU 85-389) GN=ubiE PE=3 SV=1 34 144 1.0E-08
sp|Q3ED65|MENG_ARATH 2-phytyl-1,4-beta-naphthoquinone methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=MENG PE=1 SV=2 43 162 1.0E-08
sp|P59911|UBIE_HAEDU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiE PE=3 SV=1 37 155 1.0E-08
sp|Q1RJY5|UBIE_RICBR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia bellii (strain RML369-C) GN=ubiE PE=3 SV=1 34 144 1.0E-08
sp|Q88D17|UBIE_PSEPK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain KT2440) GN=ubiE PE=3 SV=1 43 160 1.0E-08
sp|A5WA45|UBIE_PSEP1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiE PE=3 SV=1 43 160 1.0E-08
sp|A9WW74|UBIE_BRUSI Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ubiE PE=3 SV=1 32 215 1.0E-08
sp|A8GT99|UBIE_RICRS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia rickettsii (strain Sheila Smith) GN=ubiE PE=3 SV=1 43 148 1.0E-08
sp|B0BUT9|UBIE_RICRO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia rickettsii (strain Iowa) GN=ubiE PE=3 SV=1 43 148 1.0E-08
sp|A8F2G9|UBIE_RICM5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia massiliae (strain Mtu5) GN=ubiE PE=3 SV=1 43 148 1.0E-08
sp|C3PLF4|UBIE_RICAE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia africae (strain ESF-5) GN=ubiE PE=3 SV=1 43 148 1.0E-08
sp|Q9PJW4|MENG_CHLMU Demethylmenaquinone methyltransferase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=menG PE=3 SV=2 43 181 1.0E-08
sp|Q8FSB3|MENG_COREF Demethylmenaquinone methyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=menG PE=3 SV=2 37 202 2.0E-08
sp|A4QBE5|MENG_CORGB Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain R) GN=menG PE=3 SV=1 37 194 2.0E-08
sp|Q92GT5|UBIE_RICCN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ubiE PE=3 SV=1 43 148 2.0E-08
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 38 148 2.0E-08
sp|A1K8U5|TAM_AZOSB Trans-aconitate 2-methyltransferase OS=Azoarcus sp. (strain BH72) GN=tam PE=3 SV=1 42 143 2.0E-08
sp|C5BCA4|UBIE_EDWI9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Edwardsiella ictaluri (strain 93-146) GN=ubiE PE=3 SV=1 37 160 2.0E-08
sp|Q6G1I2|UBIE_BARQU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella quintana (strain Toulouse) GN=ubiE PE=3 SV=1 24 160 2.0E-08
sp|C5BRL2|UBIE_TERTT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 34 163 2.0E-08
sp|B2AH07|UBIE_CUPTR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ubiE PE=3 SV=1 37 160 2.0E-08
sp|Q8KF69|MENG_CHLTE Demethylmenaquinone methyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=menG PE=3 SV=1 43 138 2.0E-08
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 38 138 2.0E-08
sp|Q81ZX2|MENG_STRAW Demethylmenaquinone methyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=menG PE=3 SV=1 38 194 2.0E-08
sp|Q8DGE4|MENG_THEEB 2-phytyl-1,4-naphtoquinone methyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=menG PE=3 SV=1 42 162 2.0E-08
sp|Q0KEH6|UBIE_CUPNH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ubiE PE=3 SV=1 37 160 3.0E-08
sp|Q2SBD7|BIOC_HAHCH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=bioC PE=3 SV=1 43 151 3.0E-08
sp|B3PH48|UBIE_CELJU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cellvibrio japonicus (strain Ueda107) GN=ubiE PE=3 SV=1 43 160 3.0E-08
sp|B9LZA9|UBIE_GEODF Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ubiE PE=3 SV=1 23 147 4.0E-08
sp|A7GXW7|CMOB_CAMC5 tRNA (mo5U34)-methyltransferase OS=Campylobacter curvus (strain 525.92) GN=cmoB PE=3 SV=1 23 140 4.0E-08
sp|A6WZN1|TAM_OCHA4 Trans-aconitate 2-methyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tam PE=3 SV=1 43 148 4.0E-08
sp|Q1LRG9|UBIE_CUPMC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ubiE PE=3 SV=1 36 160 5.0E-08
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 37 144 5.0E-08
sp|P9WLW9|Y1498_MYCTU Uncharacterized protein Rv1498c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1498c PE=1 SV=2 27 142 5.0E-08
sp|B1W525|MENG_STRGG Demethylmenaquinone methyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=menG PE=3 SV=1 91 194 6.0E-08
sp|Q9K623|BIOC_BACHD Malonyl-[acyl-carrier protein] O-methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioC PE=3 SV=1 20 140 6.0E-08
sp|P9WFR3|MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menG PE=1 SV=1 9 194 6.0E-08
sp|P9WFR2|MENG_MYCTO Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menG PE=3 SV=1 9 194 6.0E-08
sp|A5TZT8|MENG_MYCTA Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=menG PE=3 SV=1 9 194 6.0E-08
sp|C1AKN8|MENG_MYCBT Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=menG PE=3 SV=1 9 194 6.0E-08
sp|A1KG35|MENG_MYCBP Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=menG PE=3 SV=1 9 194 6.0E-08
sp|P0A639|MENG_MYCBO Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=menG PE=3 SV=1 9 194 6.0E-08
sp|Q8NT39|MENG_CORGL Demethylmenaquinone methyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=menG PE=3 SV=1 37 194 7.0E-08
sp|Q9Z5E9|UBIE_PSEOL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (Fragment) OS=Pseudomonas oleovorans GN=ubiE PE=3 SV=1 43 138 7.0E-08
sp|A9ILA7|UBIE_BART1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ubiE PE=3 SV=1 9 150 7.0E-08
sp|Q55214|DNRC_STRS5 Aklanonic acid methyltransferase DauC OS=Streptomyces sp. (strain C5) GN=dauC PE=1 SV=1 43 141 7.0E-08
sp|Q31GD8|UBIG_THICR Ubiquinone biosynthesis O-methyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiG PE=3 SV=1 40 140 8.0E-08
sp|A5FZ96|UBIE_ACICJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Acidiphilium cryptum (strain JF-5) GN=ubiE PE=3 SV=1 38 194 8.0E-08
sp|A4WW91|UBIG_RHOS5 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiG PE=3 SV=1 41 154 8.0E-08
sp|A4SM99|UBIG_AERS4 Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 43 140 8.0E-08
sp|A8GGX8|UBIG_SERP5 Ubiquinone biosynthesis O-methyltransferase OS=Serratia proteamaculans (strain 568) GN=ubiG PE=3 SV=1 40 140 1.0E-07
sp|Q21H69|UBIE_SACD2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiE PE=3 SV=1 43 144 1.0E-07
sp|C1DCV3|UBIE_LARHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Laribacter hongkongensis (strain HLHK9) GN=ubiE PE=3 SV=1 37 196 1.0E-07
sp|D2T333|BIOC_ERWP6 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=bioC PE=3 SV=1 33 140 1.0E-07
sp|A3PSZ4|Y208_MYCSJ Uncharacterized methyltransferase Mjls_0208 OS=Mycobacterium sp. (strain JLS) GN=Mjls_0208 PE=3 SV=1 42 139 1.0E-07
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 24 154 1.0E-07
sp|B2IAI0|BIOC_XYLF2 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=bioC PE=3 SV=1 3 142 1.0E-07
sp|Q2KUG1|UBIE_BORA1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bordetella avium (strain 197N) GN=ubiE PE=3 SV=1 36 144 1.0E-07
sp|B0RCZ0|MENG_CLAMS Demethylmenaquinone methyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=menG PE=3 SV=1 91 218 2.0E-07
sp|B3QLI9|MENG_CHLP8 Demethylmenaquinone methyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=menG PE=3 SV=1 43 138 2.0E-07
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 33 147 2.0E-07
sp|O52025|ARSM_HALSA Putative arsenite methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsM PE=2 SV=1 37 153 2.0E-07
sp|Q8FZM5|TAM_BRUSU Trans-aconitate 2-methyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=tam PE=3 SV=1 43 148 2.0E-07
sp|B0CHP1|TAM_BRUSI Trans-aconitate 2-methyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=tam PE=3 SV=1 43 148 2.0E-07
sp|A5VRJ7|TAM_BRUO2 Trans-aconitate 2-methyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=tam PE=3 SV=1 43 148 2.0E-07
sp|A9M6C1|TAM_BRUC2 Trans-aconitate 2-methyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=tam PE=3 SV=1 43 148 2.0E-07
sp|Q8YI91|TAM_BRUME Trans-aconitate 2-methyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=tam PE=3 SV=2 43 148 2.0E-07
sp|Q54I98|SMT1_DICDI Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 37 139 2.0E-07
sp|C6E4U6|UBIE_GEOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sp. (strain M21) GN=ubiE PE=3 SV=1 21 150 3.0E-07
sp|B1VEN4|MENG_CORU7 Demethylmenaquinone methyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=menG PE=3 SV=1 90 194 3.0E-07
sp|C3K8U4|UBIE_PSEFS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas fluorescens (strain SBW25) GN=ubiE PE=3 SV=1 43 160 3.0E-07
sp|Q3IYM5|UBIG_RHOS4 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiG PE=3 SV=1 41 154 4.0E-07
sp|B3H0C8|UBIG_ACTP7 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiG PE=3 SV=1 43 140 4.0E-07
sp|P9WLW8|Y1498_MYCTO Uncharacterized protein MT1546 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1546 PE=4 SV=2 27 138 4.0E-07
sp|A1U9D7|Y228_MYCSK Uncharacterized methyltransferase Mkms_0228 OS=Mycobacterium sp. (strain KMS) GN=Mkms_0228 PE=3 SV=1 42 139 4.0E-07
sp|Q1BFJ5|Y218_MYCSS Uncharacterized methyltransferase Mmcs_0218 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_0218 PE=3 SV=1 42 139 4.0E-07
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 23 144 4.0E-07
sp|B2JCU8|UBIE_BURP8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiE PE=3 SV=1 36 160 4.0E-07
sp|Q5ZT34|BIOC_LEGPH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=bioC PE=3 SV=2 43 140 5.0E-07
sp|A3PNM3|UBIG_RHOS1 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiG PE=3 SV=1 41 154 5.0E-07
sp|O06898|BIOC_ESCVU Malonyl-[acyl-carrier protein] O-methyltransferase OS=Escherichia vulneris GN=bioC PE=3 SV=1 28 147 5.0E-07
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 37 154 5.0E-07
sp|A1T1P0|Y241_MYCVP Uncharacterized methyltransferase Mvan_0241 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_0241 PE=3 SV=1 41 139 5.0E-07
sp|A4T3V1|Y427_MYCGI Uncharacterized methyltransferase Mflv_0427 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_0427 PE=3 SV=1 40 139 6.0E-07
sp|Q31IM5|UBIE_THICR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiE PE=3 SV=1 37 149 6.0E-07
sp|P36999|RLMA_ECOLI 23S rRNA (guanine(745)-N(1))-methyltransferase OS=Escherichia coli (strain K12) GN=rlmA PE=1 SV=1 43 140 7.0E-07
sp|Q16DL1|UBIE_ROSDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiE PE=3 SV=1 43 148 9.0E-07
sp|C6CWS7|BIOC_PAESJ Malonyl-[acyl-carrier protein] O-methyltransferase OS=Paenibacillus sp. (strain JDR-2) GN=bioC PE=3 SV=1 43 138 9.0E-07
sp|B5EFL1|UBIE_GEOBB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ubiE PE=3 SV=1 43 150 9.0E-07
sp|Q6G577|UBIE_BARHE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ubiE PE=3 SV=1 9 160 1.0E-06
sp|B9KQJ8|UBIE_RHOSK Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiE PE=3 SV=1 38 198 1.0E-06
sp|Q3IY65|UBIE_RHOS4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiE PE=3 SV=1 38 198 1.0E-06
sp|A3PFL1|UBIE_RHOS1 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiE PE=3 SV=1 38 198 1.0E-06
sp|Q9A258|UBIE_CAUCR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ubiE PE=3 SV=1 91 196 1.0E-06
sp|B8GVY5|UBIE_CAUCN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ubiE PE=3 SV=1 91 196 1.0E-06
sp|B2HMZ9|Y473_MYCMM Uncharacterized methyltransferase MMAR_0473 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_0473 PE=3 SV=1 42 139 1.0E-06
sp|Q0WPT7|Y2104_ARATH Uncharacterized methyltransferase At2g41040, chloroplastic OS=Arabidopsis thaliana GN=At2g41040 PE=2 SV=1 43 150 1.0E-06
sp|Q3IJV7|UBIE_PSEHT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiE PE=3 SV=1 43 160 1.0E-06
sp|A5TYU9|Y232_MYCTA Uncharacterized methyltransferase MRA_0232 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_0232 PE=3 SV=1 23 142 1.0E-06
sp|P9WJZ9|Y224_MYCTU Uncharacterized methyltransferase Rv0224c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0224c PE=1 SV=1 23 142 1.0E-06
sp|P9WJZ8|Y224_MYCTO Uncharacterized methyltransferase MT0234 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0234 PE=3 SV=1 23 142 1.0E-06
sp|A1S6C9|UBIG_SHEAM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiG PE=3 SV=1 43 140 1.0E-06
sp|Q54818|DNRC_STRPE Aklanonic acid methyltransferase DnrC OS=Streptomyces peucetius GN=dnrC PE=1 SV=1 43 141 1.0E-06
sp|P36571|BIOC_SERMA Malonyl-[acyl-carrier protein] O-methyltransferase OS=Serratia marcescens GN=bioC PE=1 SV=1 39 140 2.0E-06
sp|C3LLV3|UBIG_VIBCM Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiG PE=3 SV=1 43 140 2.0E-06
sp|Q9KSJ9|UBIG_VIBCH Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiG PE=3 SV=1 43 140 2.0E-06
sp|A5F1U0|UBIG_VIBC3 Ubiquinone biosynthesis O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiG PE=3 SV=1 43 140 2.0E-06
sp|A0QMC8|Y4945_MYCA1 Uncharacterized methyltransferase MAV_4945 OS=Mycobacterium avium (strain 104) GN=MAV_4945 PE=3 SV=1 42 139 2.0E-06
sp|B4EZ30|UBIG_PROMH Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 43 140 2.0E-06
sp|Q820B5|UBIG_COXBU Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 43 138 2.0E-06
sp|A9NBI0|UBIG_COXBR Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 43 138 2.0E-06
sp|B6J1W2|UBIG_COXB2 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 43 138 2.0E-06
sp|Q216J6|TAM_RHOPB Trans-aconitate 2-methyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=tam PE=3 SV=1 43 184 2.0E-06
sp|Q3SM81|UBIE_THIDA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ubiE PE=3 SV=1 37 191 2.0E-06
sp|A8LNK7|UBIE_DINSH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ubiE PE=3 SV=1 43 148 2.0E-06
sp|B9KPP7|UBIG_RHOSK Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiG PE=3 SV=1 41 154 2.0E-06
sp|A4WVR7|UBIE_RHOS5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiE PE=3 SV=1 38 198 2.0E-06
sp|B6J5Y2|UBIG_COXB1 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 43 138 2.0E-06
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 36 143 2.0E-06
sp|A9KGL7|UBIG_COXBN Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 43 138 3.0E-06
sp|Q749W5|BIOC_GEOSL Malonyl-[acyl-carrier protein] O-methyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioC PE=3 SV=1 43 192 3.0E-06
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 42 140 3.0E-06
sp|B0UPF4|TAM_METS4 Trans-aconitate 2-methyltransferase OS=Methylobacterium sp. (strain 4-46) GN=tam PE=3 SV=1 43 143 3.0E-06
sp|Q6FFY1|UBIG_ACIAD Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 43 140 3.0E-06
sp|P59912|MENG_RHOBA Demethylmenaquinone methyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=menG PE=3 SV=1 40 149 3.0E-06
sp|A0QUV5|Y2350_MYCS2 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2350 PE=1 SV=1 43 152 3.0E-06
sp|Q0AME1|UBIG_MARMM Ubiquinone biosynthesis O-methyltransferase OS=Maricaulis maris (strain MCS10) GN=ubiG PE=3 SV=1 41 142 3.0E-06
sp|B2SX35|UBIE_BURPP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiE PE=3 SV=1 36 160 3.0E-06
sp|B1LXF6|TAM_METRJ Trans-aconitate 2-methyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=tam PE=3 SV=1 44 143 4.0E-06
sp|B2VIL6|UBIG_ERWT9 Ubiquinone biosynthesis O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiG PE=3 SV=1 43 166 4.0E-06
sp|Q5X0X6|UBIE_LEGPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Paris) GN=ubiE PE=3 SV=1 34 164 4.0E-06
sp|A5II90|UBIE_LEGPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Corby) GN=ubiE PE=3 SV=1 34 164 4.0E-06
sp|Q5WSQ8|UBIE_LEGPL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila (strain Lens) GN=ubiE PE=3 SV=1 34 164 4.0E-06
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 43 140 4.0E-06
sp|Q7N2M5|UBIG_PHOLL Ubiquinone biosynthesis O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiG PE=3 SV=1 43 140 5.0E-06
sp|A1R990|MENG_ARTAT Demethylmenaquinone methyltransferase OS=Arthrobacter aurescens (strain TC1) GN=menG PE=3 SV=1 1 192 6.0E-06
sp|Q47LE2|MENG_THEFY Demethylmenaquinone methyltransferase OS=Thermobifida fusca (strain YX) GN=menG PE=3 SV=1 91 202 7.0E-06
sp|A8LCA4|MENG_FRASN Demethylmenaquinone methyltransferase OS=Frankia sp. (strain EAN1pec) GN=menG PE=3 SV=1 97 194 7.0E-06
sp|A0PMY7|Y1123_MYCUA Uncharacterized methyltransferase MUL_1123 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_1123 PE=3 SV=1 42 139 7.0E-06
sp|Q16D32|UBIG_ROSDO Ubiquinone biosynthesis O-methyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiG PE=3 SV=1 41 154 7.0E-06
sp|A1KF44|Y261_MYCBP Uncharacterized methyltransferase BCG_0261c OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0261c PE=3 SV=1 23 142 8.0E-06
sp|Q7U2J0|Y229_MYCBO Uncharacterized methyltransferase Mb0229c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0229c PE=1 SV=1 23 142 8.0E-06
sp|Q5ZRH9|UBIE_LEGPH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ubiE PE=3 SV=1 34 160 8.0E-06
sp|C4LL93|MENG_CORK4 Demethylmenaquinone methyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=menG PE=3 SV=1 38 200 8.0E-06
sp|Q6ZLD3|BQMT1_ORYSJ 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ARSM2 PE=2 SV=1 41 142 8.0E-06
sp|Q73TQ5|Y3663_MYCPA Uncharacterized methyltransferase MAP_3663c OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_3663c PE=3 SV=1 42 139 8.0E-06
sp|B5FDT8|UBIG_VIBFM Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=ubiG PE=3 SV=1 43 140 9.0E-06
sp|Q5E5J8|UBIG_VIBF1 Ubiquinone biosynthesis O-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ubiG PE=3 SV=1 43 140 9.0E-06
sp|Q3ILA5|UBIG_PSEHT Ubiquinone biosynthesis O-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiG PE=3 SV=1 22 190 9.0E-06
sp|A8H499|UBIG_SHEPA Ubiquinone biosynthesis O-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiG PE=3 SV=1 43 140 9.0E-06
sp|Q74EU2|UBIE_GEOSL Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ubiE PE=3 SV=1 43 147 1.0E-05
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 43 140 1.0E-05
sp|B0UUV6|UBIG_HISS2 Ubiquinone biosynthesis O-methyltransferase OS=Histophilus somni (strain 2336) GN=ubiG PE=3 SV=1 43 195 1.0E-05
sp|Q7VL11|BIOC_HAEDU Malonyl-[acyl-carrier protein] O-methyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=bioC PE=3 SV=1 44 140 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006400 tRNA modification Yes
GO:0008168 methyltransferase activity Yes
GO:0008176 tRNA (guanine-N7-)-methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043412 macromolecule modification No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0016423 tRNA (guanine) methyltransferase activity No
GO:0008033 tRNA processing No
GO:0034660 ncRNA metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008173 RNA methyltransferase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0008175 tRNA methyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0009451 RNA modification No
GO:0016070 RNA metabolic process No
GO:0006399 tRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034470 ncRNA processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5445
MESKPEHVYSTDHSVAVLRTHRWRTLANSAGYLLPHLRPDMTILDVGCGPGSITIDLARAVPQGNVTGVEYVPDP
LDGARADAQAQAITNVSFIVADAHHLPFPDASFDVVHAHQVLQHLADPVQALREMRRVVKPGGLVACRESASMTW
HPESKGIEAWLQLTTRVARAKGGNPHPGSRIHVWAEQAGFASEMVEKSAGAWCFASAEERAYWGGSMAERAASSG
FGEVAVEGGFATREELEGIGRGGGVGGGDGGGDGGGAGCGIGIGGIGAGSGVRGGDGSGRDEVGLSGFMFLYSV*
Coding >Ophun1|5445
ATGGAATCCAAGCCGGAGCATGTCTACTCGACCGATCACTCGGTTGCTGTCCTTCGTACTCACCGCTGGCGTACC
CTCGCCAACTCGGCTGGCTACCTGCTTCCTCATCTTCGGCCGGATATGACCATTCTTGACGTTGGGTGCGGGCCG
GGCTCTATTACTATTGATCTGGCGAGGGCTGTGCCGCAGGGAAATGTTACGGGCGTCGAATACGTGCCTGATCCG
CTTGACGGTGCCCGCGCAGACGCCCAGGCACAGGCCATCACCAACGTCTCCTTCATCGTGGCCGACGCCCATCAT
CTGCCCTTCCCGGACGCCTCTTTCGACGTCGTTCATGCTCATCAGGTGCTACAGCATCTTGCCGATCCGGTCCAG
GCTCTGCGTGAGATGCGCCGCGTCGTGAAGCCAGGAGGTCTCGTCGCCTGCCGCGAATCAGCCTCGATGACATGG
CACCCCGAGTCCAAGGGTATAGAAGCCTGGCTGCAGCTGACGACGCGCGTGGCCCGTGCCAAAGGTGGGAACCCG
CATCCTGGCAGTCGGATCCACGTCTGGGCTGAGCAGGCTGGGTTTGCGAGCGAGATGGTTGAGAAGAGCGCTGGG
GCGTGGTGCTTTGCCTCGGCGGAGGAGAGGGCTTACTGGGGGGGGTCTATGGCCGAGAGGGCGGCGTCTTCGGGC
TTTGGAGAGGTGGCGGTTGAGGGGGGGTTTGCGACGAGGGAGGAGCTGGAGGGGATTGGGCGCGGCGGCGGTGTC
GGGGGCGGCGATGGGGGAGGCGACGGGGGCGGCGCTGGGTGCGGCATCGGCATCGGCGGCATCGGCGCCGGCTCG
GGGGTGCGCGGAGGTGACGGCTCGGGACGCGATGAGGTCGGACTCTCTGGCTTCATGTTTCTGTACTCGGTCTAG
Transcript >Ophun1|5445
ATGGAATCCAAGCCGGAGCATGTCTACTCGACCGATCACTCGGTTGCTGTCCTTCGTACTCACCGCTGGCGTACC
CTCGCCAACTCGGCTGGCTACCTGCTTCCTCATCTTCGGCCGGATATGACCATTCTTGACGTTGGGTGCGGGCCG
GGCTCTATTACTATTGATCTGGCGAGGGCTGTGCCGCAGGGAAATGTTACGGGCGTCGAATACGTGCCTGATCCG
CTTGACGGTGCCCGCGCAGACGCCCAGGCACAGGCCATCACCAACGTCTCCTTCATCGTGGCCGACGCCCATCAT
CTGCCCTTCCCGGACGCCTCTTTCGACGTCGTTCATGCTCATCAGGTGCTACAGCATCTTGCCGATCCGGTCCAG
GCTCTGCGTGAGATGCGCCGCGTCGTGAAGCCAGGAGGTCTCGTCGCCTGCCGCGAATCAGCCTCGATGACATGG
CACCCCGAGTCCAAGGGTATAGAAGCCTGGCTGCAGCTGACGACGCGCGTGGCCCGTGCCAAAGGTGGGAACCCG
CATCCTGGCAGTCGGATCCACGTCTGGGCTGAGCAGGCTGGGTTTGCGAGCGAGATGGTTGAGAAGAGCGCTGGG
GCGTGGTGCTTTGCCTCGGCGGAGGAGAGGGCTTACTGGGGGGGGTCTATGGCCGAGAGGGCGGCGTCTTCGGGC
TTTGGAGAGGTGGCGGTTGAGGGGGGGTTTGCGACGAGGGAGGAGCTGGAGGGGATTGGGCGCGGCGGCGGTGTC
GGGGGCGGCGATGGGGGAGGCGACGGGGGCGGCGCTGGGTGCGGCATCGGCATCGGCGGCATCGGCGCCGGCTCG
GGGGTGCGCGGAGGTGACGGCTCGGGACGCGATGAGGTCGGACTCTCTGGCTTCATGTTTCTGTACTCGGTCTAG
Gene >Ophun1|5445
ATGGAATCCAAGCCGGAGCATGTCTACTCGACCGATCACTCGGTTGCTGTCCTTCGTACTCACCGCTGGCGTACC
CTCGCCAACTCGGCTGGCTACCTGCTTCCTCATCTTCGGCCGGATATGACCATTCTTGACGTTGGGTGCGGGCCG
GGCTCTATTACTATTGATCTGGCGAGGGCTGTGCCGCAGGGAAATGTTACGGGCGTCGAATACGTGCCTGATCCG
CTTGACGGTGCCCGCGCAGACGCCCAGGCACAGGCCATCACCAACGTCTCCTTCATCGTGGCCGACGCCCATCAT
CTGCCCTTCCCGGACGCCTCTTTCGACGTCGTTCATGCTCATCAGGTGCTACAGCATCTTGCCGATCCGGTCCAG
GCTCTGCGTGAGATGCGCCGCGTCGTGAAGCCAGGAGGTCTCGTCGCCTGCCGCGAATCAGCCTCGATGACATGG
CACCCCGAGTCCAAGGGTATAGAAGCCTGGCTGCAGCTGACGACGCGCGTGGCCCGTGCCAAAGGTGGGAACCCG
CATCCTGGCAGTCGGATCCACGTCTGGGCTGAGCAGGCTGGGTTTGCGAGCGAGATGGTTGAGAAGAGCGCTGGG
GCGTGGTGCTTTGCCTCGGCGGAGGAGAGGGCTTACTGGGGGGGGTCTATGGCCGAGAGGGCGGCGTCTTCGGGC
TTTGGAGAGGTGGCGGTTGAGGGGGGGTTTGCGACGAGGGAGGAGCTGGAGGGGATTGGGCGTGCTTGGGGGGTG
TTTGCTGGGGACTCCGAGGCTTGGTTTGGGTTGCTTCATGGTCAGATTTTGTGTAGGAGGACTTAGCTGGGGTTG
GGAGGGAATGCTTTCTGTCACTTGGACTTGGATGGAGTCAAGACCAAGATTTATGAATCAAGAATGGGTAAAGCC
TCTGTGAATCTCATCGTCTTCTCTCGTAAAGTCTTGGTGAAAGACTGAGTGTAACATCTCGTGCTAACATGGTCA
ATAATACCATGCAATGCCCGACATAACAAAATGGACATCATTGCATCGTCATTGACCAGCTCGTTACAGGGCGCC
CTCCTACTCTTGAAGTCAAGTTCAACCCCGAACCCACCCACAGAAGCCACGGAAAGAGTTCGCCATTCCCCGATC
CCGGTTCAAGACTCGATGGAGCTGCTTCCATTCCGAGATGGGCTGGAGGCCGATCAGCAAACGACGCAGATTGAG
CCTCTCTCGGGATTAGACTCTCTACTTGTGAAAGAAGCTTGTCCATTCTCCCTGTTAGGGCCAGGCGCTGTGACC
CGATACAGGGAGTGTTACCCGGCGAACCACGGTAGCGTCGGCTTTATGCCTCTGCAGGCGGCGGCGGTGTCGGGG
GCGGCGATGGGGGAGGCGACGGGGGCGGCGCTGGGTGCGGCATCGGCATCGGCGGCATCGGCGCCGGCTCGGGGG
TGCGCGGAGGTGACGGCTCGGGACGCGATGAGGTCGGACTCTCTGGCTTCATGTTTCTGTACTCGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail