Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5443
Gene name
LocationContig_539:9764..12269
Strand+
Gene length (bp)2505
Transcript length (bp)2505
Coding sequence length (bp)2505
Protein length (aa) 835

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 7.0E-21 736 815
PF04408 HA2 Helicase associated domain (HA2) 2.6E-17 587 677
PF00271 Helicase_C Helicase conserved C-terminal domain 8.0E-14 398 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 5 834 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 5 832 0.0E+00
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 1 833 0.0E+00
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 1 833 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 5 832 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 5 834 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 5 832 0.0E+00
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 1 833 0.0E+00
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 1 833 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 5 832 0.0E+00
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 1 833 0.0E+00
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 1 834 0.0E+00
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 4 832 0.0E+00
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 39 833 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 156 829 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 180 829 0.0E+00
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 180 829 0.0E+00
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 180 829 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 117 833 0.0E+00
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 78 818 0.0E+00
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 118 829 0.0E+00
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 173 829 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 186 821 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 118 820 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 174 820 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 186 833 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 184 819 0.0E+00
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 187 829 0.0E+00
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 187 829 0.0E+00
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 184 829 0.0E+00
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 187 829 0.0E+00
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 186 821 0.0E+00
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 185 829 0.0E+00
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 182 829 0.0E+00
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 157 817 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 187 833 0.0E+00
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 186 833 0.0E+00
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 168 820 0.0E+00
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 186 820 0.0E+00
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 187 815 0.0E+00
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 187 827 0.0E+00
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 178 816 1.0E-179
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 193 830 9.0E-176
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 182 820 1.0E-172
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 184 830 1.0E-171
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 186 820 1.0E-170
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 168 817 2.0E-152
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 175 817 5.0E-152
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 177 817 8.0E-152
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 175 817 2.0E-151
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 288 720 2.0E-149
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 185 809 8.0E-141
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 181 815 3.0E-134
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 149 819 3.0E-123
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 193 819 1.0E-110
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 173 717 2.0E-109
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 173 717 4.0E-109
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 194 834 4.0E-107
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 185 834 8.0E-104
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 187 813 6.0E-100
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 179 799 6.0E-98
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 191 817 1.0E-94
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 191 817 3.0E-91
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 191 817 6.0E-90
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 149 760 1.0E-87
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 181 700 1.0E-82
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 194 753 9.0E-81
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 169 753 1.0E-80
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 173 704 1.0E-80
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 173 704 2.0E-80
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 189 816 5.0E-80
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 194 753 2.0E-79
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 191 804 7.0E-78
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 126 774 1.0E-77
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 126 774 2.0E-77
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 163 774 2.0E-77
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 189 816 2.0E-75
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 159 774 3.0E-75
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 89 685 1.0E-74
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 189 649 4.0E-72
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 191 816 4.0E-71
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 191 749 9.0E-69
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 193 626 4.0E-68
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 176 788 2.0E-67
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 194 747 1.0E-64
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 192 747 1.0E-61
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 191 747 8.0E-61
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 192 757 4.0E-60
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 194 721 4.0E-60
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 190 684 5.0E-60
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 192 747 6.0E-60
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 192 747 8.0E-60
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 193 696 8.0E-57
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 192 757 8.0E-57
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 178 747 2.0E-56
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 192 747 1.0E-55
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 192 747 1.0E-54
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 194 721 2.0E-54
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 192 747 3.0E-53
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 194 721 1.0E-52
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 192 747 2.0E-52
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 404 798 2.0E-52
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 194 721 3.0E-52
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 192 747 9.0E-52
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 404 798 3.0E-51
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 187 416 1.0E-50
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 437 824 5.0E-49
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 187 416 4.0E-48
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 396 799 5.0E-47
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 437 813 6.0E-47
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 187 439 1.0E-46
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 404 804 1.0E-45
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 403 799 1.0E-45
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 141 378 4.0E-45
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 404 804 5.0E-45
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 187 418 2.0E-44
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 187 417 2.0E-44
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 395 775 3.0E-44
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 395 775 3.0E-44
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 403 804 4.0E-44
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 397 774 3.0E-43
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 141 378 6.0E-43
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 403 799 6.0E-43
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 177 673 6.0E-42
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 191 378 3.0E-41
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 191 378 3.0E-41
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 379 751 1.0E-40
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 191 378 4.0E-40
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 183 378 5.0E-40
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 187 378 7.0E-40
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 436 813 8.0E-40
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 437 816 2.0E-39
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 404 770 3.0E-39
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 404 778 7.0E-39
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 169 374 3.0E-38
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 437 832 4.0E-38
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 406 750 4.0E-38
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 78 374 2.0E-37
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 211 613 2.0E-37
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 191 374 6.0E-37
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 193 614 6.0E-37
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 191 374 7.0E-37
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 211 613 1.0E-36
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 211 613 1.0E-36
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 211 613 2.0E-36
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 211 613 2.0E-35
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 189 389 3.0E-34
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 159 378 4.0E-34
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 161 378 2.0E-32
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 187 378 1.0E-30
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 163 569 2.0E-30
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 187 378 2.0E-29
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 404 680 9.0E-23
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 404 775 7.0E-13
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 542 775 2.0E-12
sp|Q9Q8Q2|NPH2_MYXVL RNA helicase NPH-II OS=Myxoma virus (strain Lausanne) GN=NPH2 PE=3 SV=1 213 542 5.0E-12
sp|Q9Q927|NPH2_RFVKA RNA helicase NPH-II OS=Rabbit fibroma virus (strain Kasza) GN=NPH2 PE=2 SV=1 213 533 2.0E-08
sp|Q01206|POL1_BAYMJ Genome polyprotein 1 OS=Barley yellow mosaic virus (strain Japanese II-1) PE=3 SV=1 214 527 3.0E-08
sp|P90245|POL1_BAMMN Genome polyprotein 1 OS=Barley mild mosaic virus (strain Na1) PE=3 SV=1 206 527 3.0E-08
sp|Q04574|POL1_BAYMG Genome polyprotein 1 OS=Barley yellow mosaic virus (isolate Germany) PE=3 SV=1 214 527 4.0E-08
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 201 367 3.0E-07
sp|Q9YJW3|POL1_BAYMY Genome polyprotein 1 OS=Barley yellow mosaic virus (isolate China/Yancheng/1998) PE=3 SV=1 214 527 5.0E-07
sp|Q98218|NPH2_MCV1 RNA helicase NPH-II OS=Molluscum contagiosum virus subtype 1 GN=NPH2 PE=3 SV=1 301 533 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup12
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7861
Ophiocordyceps australis 1348a (Ghana) OphauG2|6896
Ophiocordyceps australis 1348a (Ghana) OphauG2|6506
Ophiocordyceps australis 1348a (Ghana) OphauG2|3168
Ophiocordyceps australis 1348a (Ghana) OphauG2|20
Ophiocordyceps australis map64 (Brazil) OphauB2|5123
Ophiocordyceps australis map64 (Brazil) OphauB2|2680
Ophiocordyceps australis map64 (Brazil) OphauB2|2813
Ophiocordyceps australis map64 (Brazil) OphauB2|2015
Ophiocordyceps australis map64 (Brazil) OphauB2|2149
Ophiocordyceps camponoti-floridani Ophcf2|01559
Ophiocordyceps camponoti-floridani Ophcf2|06888
Ophiocordyceps camponoti-floridani Ophcf2|06302
Ophiocordyceps camponoti-floridani Ophcf2|00261
Ophiocordyceps camponoti-floridani Ophcf2|05778
Ophiocordyceps camponoti-rufipedis Ophun1|1146
Ophiocordyceps camponoti-rufipedis Ophun1|308
Ophiocordyceps camponoti-rufipedis Ophun1|5443 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6690
Ophiocordyceps camponoti-rufipedis Ophun1|6277
Ophiocordyceps kimflemingae Ophio5|3066
Ophiocordyceps kimflemingae Ophio5|4511
Ophiocordyceps kimflemingae Ophio5|5562
Ophiocordyceps kimflemingae Ophio5|6072
Ophiocordyceps kimflemingae Ophio5|7318
Ophiocordyceps subramaniannii Hirsu2|9346
Ophiocordyceps subramaniannii Hirsu2|8271
Ophiocordyceps subramaniannii Hirsu2|11264
Ophiocordyceps subramaniannii Hirsu2|10215
Ophiocordyceps subramaniannii Hirsu2|10021

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5443
MPDQRARSRREYLKKRETERQALLRKQVAEEAAELHSGLRLSEREKAEFAKNRENLRRADERRRINDHRDGYVMP
EDYITEKGKLDKRKKEEALNKRHVDRDEYGQERFVTEHEEWEREQTAKAKAQIQRTEREDDEYGYVLDNAQYIQW
SLDSRLAGEGKTLLAKTQKQLLLDAQIEEAEKKALSIQETRKSLPIYQYRDQFLAALEEYQILVIVGETGSGKTT
QLPQYLHEAGYTKDGMKVGCTQPRRVAAMSVAARVADEVGVKVGNEVGYSIRFEDCTGDKTVLKYMTDGMLLREF
MTEPDLAGYSALMIDEAHERTVHTDILLALVKDLARERRDLKLLISSATMNATKFSEYFDDAPIFNIPGRRYPVD
IYYTPAPEANYLAAAITTTFQIHTTQGKGDILIFLTGQDEIEAAELEISETARKLGSRIKELVICPIYANLPSDL
QAKIFEPTPEGARKVVLATNIAETSLTIDGIVYVIDPGYVKENLYNPATGMSNLVAVPCSRASANQRSGRAGRVG
PGKCFRLYTKFAYMNEMDESTTPEIQRTNLNGVVLQLMSLGVNDVLNFEFMDPPPIEALTGALNQLFALQALNHR
GELTKLGRQMAEFPTDPMLAKAVLAADGEGCVEEVLSIVSMLGEASALFFRPKDKKIHADSARNRFTVREGGDHL
TLLNVWTQWVDSDFSPVWARENFLQQRSLTRARDVRDQLAKLCDRVEVSPSTCGAANLGPIKRAITAGFFPNAAR
LQRSGDGYRLVKNGTGVWIHPSSVLMAVDPPEKMVLYFELVQTSKEYMRSVMPIEAAWLAELAPHFHRKKDIEEL
EEKKMPRKR*
Coding >Ophun1|5443
ATGCCTGACCAGCGCGCAAGGTCGCGACGAGAATACCTCAAGAAGCGCGAGACGGAGCGCCAGGCGCTGCTGCGG
AAACAAGTGGCCGAGGAGGCGGCCGAGCTGCACAGCGGTCTGCGACTGTCGGAGAGGGAAAAGGCCGAGTTCGCC
AAGAACCGCGAGAATCTTCGACGGGCCGACGAACGACGGCGAATCAACGATCATCGCGATGGATACGTGATGCCA
GAGGATTACATTACGGAAAAGGGCAAGCTCGACAAGCGCAAGAAGGAAGAGGCTCTCAACAAGCGGCACGTCGAC
AGGGATGAGTACGGTCAGGAGAGGTTCGTAACGGAGCACGAGGAGTGGGAGCGAGAGCAGACGGCCAAGGCCAAG
GCGCAGATTCAACGGACCGAGCGCGAGGACGACGAGTATGGCTACGTCCTAGACAACGCCCAATACATTCAATGG
AGTCTAGACTCGAGGCTGGCGGGCGAGGGCAAGACGTTGCTGGCAAAGACTCAGAAGCAGCTGTTGCTCGATGCT
CAGATCGAGGAGGCCGAGAAGAAGGCGCTGTCGATACAAGAGACGCGGAAGAGTCTGCCCATCTACCAGTACCGC
GATCAGTTCCTGGCCGCACTGGAGGAGTACCAGATCCTCGTCATCGTCGGCGAGACGGGCAGCGGCAAGACGACG
CAGCTGCCGCAGTACCTGCACGAGGCTGGCTATACAAAGGACGGCATGAAGGTCGGCTGCACCCAGCCTCGGCGA
GTGGCAGCCATGAGTGTGGCGGCTCGAGTGGCAGACGAGGTGGGAGTCAAGGTCGGCAACGAGGTCGGCTACTCG
ATCCGCTTCGAGGACTGTACGGGCGACAAGACGGTGCTTAAATACATGACGGACGGCATGCTGCTACGCGAGTTC
ATGACGGAGCCTGACCTGGCTGGCTATTCGGCCCTGATGATCGACGAGGCTCATGAGCGTACCGTTCATACAGAT
ATCCTGCTAGCTCTCGTCAAAGATCTGGCGCGGGAACGGCGTGACTTGAAGCTGCTGATCTCGTCAGCCACCATG
AACGCGACCAAGTTCTCCGAATACTTTGACGACGCGCCCATCTTCAACATTCCCGGACGACGATACCCCGTCGAC
ATCTACTACACGCCCGCCCCCGAGGCGAACTACCTCGCAGCCGCCATCACGACGACGTTTCAGATCCACACGACG
CAGGGCAAGGGCGATATCCTCATCTTCCTAACCGGCCAGGACGAGATCGAAGCCGCCGAGCTGGAAATCTCGGAG
ACGGCCCGCAAGCTGGGCAGCCGTATCAAGGAGCTCGTCATCTGTCCCATCTACGCCAACCTTCCTTCGGACCTA
CAGGCCAAGATCTTCGAGCCGACACCAGAGGGTGCGCGAAAGGTAGTGCTGGCAACCAACATCGCCGAGACGAGT
CTGACCATCGACGGCATCGTCTACGTCATCGACCCGGGCTACGTCAAGGAGAACCTCTACAACCCTGCCACGGGC
ATGTCCAACCTGGTGGCCGTCCCCTGCTCGCGCGCCTCAGCCAACCAGCGCAGCGGTCGAGCCGGACGCGTCGGC
CCGGGGAAGTGCTTCCGGCTATACACCAAGTTTGCATACATGAACGAGATGGACGAGTCGACGACGCCGGAGATA
CAGAGGACTAACCTCAACGGCGTGGTGCTACAGCTCATGTCCCTCGGCGTCAACGACGTGCTCAACTTTGAATTC
ATGGATCCGCCACCCATCGAAGCCCTCACCGGCGCCCTCAACCAGCTCTTCGCTCTGCAAGCCCTCAACCACCGC
GGCGAGCTGACCAAGCTCGGCCGCCAGATGGCAGAGTTCCCTACGGATCCGATGCTGGCCAAGGCGGTGCTGGCA
GCCGACGGCGAGGGCTGCGTAGAGGAAGTCCTCTCGATCGTCTCCATGCTCGGCGAAGCCTCAGCCCTCTTCTTC
CGACCCAAGGACAAGAAGATTCACGCCGACAGCGCGCGGAACCGCTTCACCGTCCGCGAGGGAGGCGACCACCTC
ACCCTCCTCAACGTCTGGACGCAATGGGTCGACAGCGACTTCTCCCCCGTCTGGGCCCGCGAGAACTTCCTCCAG
CAGCGATCCCTAACGCGAGCCCGCGACGTCAGGGACCAGCTCGCCAAGCTCTGCGACCGCGTCGAAGTCTCCCCC
TCAACCTGCGGCGCCGCAAACCTCGGCCCCATCAAGCGCGCCATCACCGCGGGCTTCTTCCCCAACGCGGCGCGC
CTGCAGCGAAGCGGCGACGGGTACCGCCTCGTCAAGAACGGGACGGGCGTTTGGATCCATCCCAGCAGCGTGCTC
ATGGCTGTGGACCCGCCCGAGAAGATGGTGCTCTACTTTGAGCTCGTCCAGACTTCCAAGGAGTATATGCGTAGT
GTTATGCCGATTGAGGCGGCGTGGTTGGCTGAGCTGGCGCCTCATTTTCATCGGAAGAAGGATATTGAGGAGTTG
GAGGAAAAGAAGATGCCGAGGAAGAGGTAG
Transcript >Ophun1|5443
ATGCCTGACCAGCGCGCAAGGTCGCGACGAGAATACCTCAAGAAGCGCGAGACGGAGCGCCAGGCGCTGCTGCGG
AAACAAGTGGCCGAGGAGGCGGCCGAGCTGCACAGCGGTCTGCGACTGTCGGAGAGGGAAAAGGCCGAGTTCGCC
AAGAACCGCGAGAATCTTCGACGGGCCGACGAACGACGGCGAATCAACGATCATCGCGATGGATACGTGATGCCA
GAGGATTACATTACGGAAAAGGGCAAGCTCGACAAGCGCAAGAAGGAAGAGGCTCTCAACAAGCGGCACGTCGAC
AGGGATGAGTACGGTCAGGAGAGGTTCGTAACGGAGCACGAGGAGTGGGAGCGAGAGCAGACGGCCAAGGCCAAG
GCGCAGATTCAACGGACCGAGCGCGAGGACGACGAGTATGGCTACGTCCTAGACAACGCCCAATACATTCAATGG
AGTCTAGACTCGAGGCTGGCGGGCGAGGGCAAGACGTTGCTGGCAAAGACTCAGAAGCAGCTGTTGCTCGATGCT
CAGATCGAGGAGGCCGAGAAGAAGGCGCTGTCGATACAAGAGACGCGGAAGAGTCTGCCCATCTACCAGTACCGC
GATCAGTTCCTGGCCGCACTGGAGGAGTACCAGATCCTCGTCATCGTCGGCGAGACGGGCAGCGGCAAGACGACG
CAGCTGCCGCAGTACCTGCACGAGGCTGGCTATACAAAGGACGGCATGAAGGTCGGCTGCACCCAGCCTCGGCGA
GTGGCAGCCATGAGTGTGGCGGCTCGAGTGGCAGACGAGGTGGGAGTCAAGGTCGGCAACGAGGTCGGCTACTCG
ATCCGCTTCGAGGACTGTACGGGCGACAAGACGGTGCTTAAATACATGACGGACGGCATGCTGCTACGCGAGTTC
ATGACGGAGCCTGACCTGGCTGGCTATTCGGCCCTGATGATCGACGAGGCTCATGAGCGTACCGTTCATACAGAT
ATCCTGCTAGCTCTCGTCAAAGATCTGGCGCGGGAACGGCGTGACTTGAAGCTGCTGATCTCGTCAGCCACCATG
AACGCGACCAAGTTCTCCGAATACTTTGACGACGCGCCCATCTTCAACATTCCCGGACGACGATACCCCGTCGAC
ATCTACTACACGCCCGCCCCCGAGGCGAACTACCTCGCAGCCGCCATCACGACGACGTTTCAGATCCACACGACG
CAGGGCAAGGGCGATATCCTCATCTTCCTAACCGGCCAGGACGAGATCGAAGCCGCCGAGCTGGAAATCTCGGAG
ACGGCCCGCAAGCTGGGCAGCCGTATCAAGGAGCTCGTCATCTGTCCCATCTACGCCAACCTTCCTTCGGACCTA
CAGGCCAAGATCTTCGAGCCGACACCAGAGGGTGCGCGAAAGGTAGTGCTGGCAACCAACATCGCCGAGACGAGT
CTGACCATCGACGGCATCGTCTACGTCATCGACCCGGGCTACGTCAAGGAGAACCTCTACAACCCTGCCACGGGC
ATGTCCAACCTGGTGGCCGTCCCCTGCTCGCGCGCCTCAGCCAACCAGCGCAGCGGTCGAGCCGGACGCGTCGGC
CCGGGGAAGTGCTTCCGGCTATACACCAAGTTTGCATACATGAACGAGATGGACGAGTCGACGACGCCGGAGATA
CAGAGGACTAACCTCAACGGCGTGGTGCTACAGCTCATGTCCCTCGGCGTCAACGACGTGCTCAACTTTGAATTC
ATGGATCCGCCACCCATCGAAGCCCTCACCGGCGCCCTCAACCAGCTCTTCGCTCTGCAAGCCCTCAACCACCGC
GGCGAGCTGACCAAGCTCGGCCGCCAGATGGCAGAGTTCCCTACGGATCCGATGCTGGCCAAGGCGGTGCTGGCA
GCCGACGGCGAGGGCTGCGTAGAGGAAGTCCTCTCGATCGTCTCCATGCTCGGCGAAGCCTCAGCCCTCTTCTTC
CGACCCAAGGACAAGAAGATTCACGCCGACAGCGCGCGGAACCGCTTCACCGTCCGCGAGGGAGGCGACCACCTC
ACCCTCCTCAACGTCTGGACGCAATGGGTCGACAGCGACTTCTCCCCCGTCTGGGCCCGCGAGAACTTCCTCCAG
CAGCGATCCCTAACGCGAGCCCGCGACGTCAGGGACCAGCTCGCCAAGCTCTGCGACCGCGTCGAAGTCTCCCCC
TCAACCTGCGGCGCCGCAAACCTCGGCCCCATCAAGCGCGCCATCACCGCGGGCTTCTTCCCCAACGCGGCGCGC
CTGCAGCGAAGCGGCGACGGGTACCGCCTCGTCAAGAACGGGACGGGCGTTTGGATCCATCCCAGCAGCGTGCTC
ATGGCTGTGGACCCGCCCGAGAAGATGGTGCTCTACTTTGAGCTCGTCCAGACTTCCAAGGAGTATATGCGTAGT
GTTATGCCGATTGAGGCGGCGTGGTTGGCTGAGCTGGCGCCTCATTTTCATCGGAAGAAGGATATTGAGGAGTTG
GAGGAAAAGAAGATGCCGAGGAAGAGGTAG
Gene >Ophun1|5443
ATGCCTGACCAGCGCGCAAGGTCGCGACGAGAATACCTCAAGAAGCGCGAGACGGAGCGCCAGGCGCTGCTGCGG
AAACAAGTGGCCGAGGAGGCGGCCGAGCTGCACAGCGGTCTGCGACTGTCGGAGAGGGAAAAGGCCGAGTTCGCC
AAGAACCGCGAGAATCTTCGACGGGCCGACGAACGACGGCGAATCAACGATCATCGCGATGGATACGTGATGCCA
GAGGATTACATTACGGAAAAGGGCAAGCTCGACAAGCGCAAGAAGGAAGAGGCTCTCAACAAGCGGCACGTCGAC
AGGGATGAGTACGGTCAGGAGAGGTTCGTAACGGAGCACGAGGAGTGGGAGCGAGAGCAGACGGCCAAGGCCAAG
GCGCAGATTCAACGGACCGAGCGCGAGGACGACGAGTATGGCTACGTCCTAGACAACGCCCAATACATTCAATGG
AGTCTAGACTCGAGGCTGGCGGGCGAGGGCAAGACGTTGCTGGCAAAGACTCAGAAGCAGCTGTTGCTCGATGCT
CAGATCGAGGAGGCCGAGAAGAAGGCGCTGTCGATACAAGAGACGCGGAAGAGTCTGCCCATCTACCAGTACCGC
GATCAGTTCCTGGCCGCACTGGAGGAGTACCAGATCCTCGTCATCGTCGGCGAGACGGGCAGCGGCAAGACGACG
CAGCTGCCGCAGTACCTGCACGAGGCTGGCTATACAAAGGACGGCATGAAGGTCGGCTGCACCCAGCCTCGGCGA
GTGGCAGCCATGAGTGTGGCGGCTCGAGTGGCAGACGAGGTGGGAGTCAAGGTCGGCAACGAGGTCGGCTACTCG
ATCCGCTTCGAGGACTGTACGGGCGACAAGACGGTGCTTAAATACATGACGGACGGCATGCTGCTACGCGAGTTC
ATGACGGAGCCTGACCTGGCTGGCTATTCGGCCCTGATGATCGACGAGGCTCATGAGCGTACCGTTCATACAGAT
ATCCTGCTAGCTCTCGTCAAAGATCTGGCGCGGGAACGGCGTGACTTGAAGCTGCTGATCTCGTCAGCCACCATG
AACGCGACCAAGTTCTCCGAATACTTTGACGACGCGCCCATCTTCAACATTCCCGGACGACGATACCCCGTCGAC
ATCTACTACACGCCCGCCCCCGAGGCGAACTACCTCGCAGCCGCCATCACGACGACGTTTCAGATCCACACGACG
CAGGGCAAGGGCGATATCCTCATCTTCCTAACCGGCCAGGACGAGATCGAAGCCGCCGAGCTGGAAATCTCGGAG
ACGGCCCGCAAGCTGGGCAGCCGTATCAAGGAGCTCGTCATCTGTCCCATCTACGCCAACCTTCCTTCGGACCTA
CAGGCCAAGATCTTCGAGCCGACACCAGAGGGTGCGCGAAAGGTAGTGCTGGCAACCAACATCGCCGAGACGAGT
CTGACCATCGACGGCATCGTCTACGTCATCGACCCGGGCTACGTCAAGGAGAACCTCTACAACCCTGCCACGGGC
ATGTCCAACCTGGTGGCCGTCCCCTGCTCGCGCGCCTCAGCCAACCAGCGCAGCGGTCGAGCCGGACGCGTCGGC
CCGGGGAAGTGCTTCCGGCTATACACCAAGTTTGCATACATGAACGAGATGGACGAGTCGACGACGCCGGAGATA
CAGAGGACTAACCTCAACGGCGTGGTGCTACAGCTCATGTCCCTCGGCGTCAACGACGTGCTCAACTTTGAATTC
ATGGATCCGCCACCCATCGAAGCCCTCACCGGCGCCCTCAACCAGCTCTTCGCTCTGCAAGCCCTCAACCACCGC
GGCGAGCTGACCAAGCTCGGCCGCCAGATGGCAGAGTTCCCTACGGATCCGATGCTGGCCAAGGCGGTGCTGGCA
GCCGACGGCGAGGGCTGCGTAGAGGAAGTCCTCTCGATCGTCTCCATGCTCGGCGAAGCCTCAGCCCTCTTCTTC
CGACCCAAGGACAAGAAGATTCACGCCGACAGCGCGCGGAACCGCTTCACCGTCCGCGAGGGAGGCGACCACCTC
ACCCTCCTCAACGTCTGGACGCAATGGGTCGACAGCGACTTCTCCCCCGTCTGGGCCCGCGAGAACTTCCTCCAG
CAGCGATCCCTAACGCGAGCCCGCGACGTCAGGGACCAGCTCGCCAAGCTCTGCGACCGCGTCGAAGTCTCCCCC
TCAACCTGCGGCGCCGCAAACCTCGGCCCCATCAAGCGCGCCATCACCGCGGGCTTCTTCCCCAACGCGGCGCGC
CTGCAGCGAAGCGGCGACGGGTACCGCCTCGTCAAGAACGGGACGGGCGTTTGGATCCATCCCAGCAGCGTGCTC
ATGGCTGTGGACCCGCCCGAGAAGATGGTGCTCTACTTTGAGCTCGTCCAGACTTCCAAGGAGTATATGCGTAGT
GTTATGCCGATTGAGGCGGCGTGGTTGGCTGAGCTGGCGCCTCATTTTCATCGGAAGAAGGATATTGAGGAGTTG
GAGGAAAAGAAGATGCCGAGGAAGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail