Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5436
Gene name
LocationContig_538:5929..6439
Strand-
Gene length (bp)510
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03259 Robl_LC7 Roadblock/LC7 domain 2.6E-06 79 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP97|DLRB1_HUMAN Dynein light chain roadblock-type 1 OS=Homo sapiens GN=DYNLRB1 PE=1 SV=3 64 132 1.0E-08
sp|P62628|DLRB1_RAT Dynein light chain roadblock-type 1 OS=Rattus norvegicus GN=Dynlrb1 PE=1 SV=3 64 132 3.0E-08
sp|P62627|DLRB1_MOUSE Dynein light chain roadblock-type 1 OS=Mus musculus GN=Dynlrb1 PE=1 SV=3 64 132 3.0E-08
sp|Q3T140|DLRB1_BOVIN Dynein light chain roadblock-type 1 OS=Bos taurus GN=DYNLRB1 PE=3 SV=1 64 132 3.0E-08
sp|Q8TF09|DLRB2_HUMAN Dynein light chain roadblock-type 2 OS=Homo sapiens GN=DYNLRB2 PE=1 SV=1 67 132 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP97|DLRB1_HUMAN Dynein light chain roadblock-type 1 OS=Homo sapiens GN=DYNLRB1 PE=1 SV=3 64 132 1.0E-08
sp|P62628|DLRB1_RAT Dynein light chain roadblock-type 1 OS=Rattus norvegicus GN=Dynlrb1 PE=1 SV=3 64 132 3.0E-08
sp|P62627|DLRB1_MOUSE Dynein light chain roadblock-type 1 OS=Mus musculus GN=Dynlrb1 PE=1 SV=3 64 132 3.0E-08
sp|Q3T140|DLRB1_BOVIN Dynein light chain roadblock-type 1 OS=Bos taurus GN=DYNLRB1 PE=3 SV=1 64 132 3.0E-08
sp|Q8TF09|DLRB2_HUMAN Dynein light chain roadblock-type 2 OS=Homo sapiens GN=DYNLRB2 PE=1 SV=1 67 132 3.0E-07
sp|Q32P85|DLRB2_BOVIN Dynein light chain roadblock-type 2 OS=Bos taurus GN=DYNLRB2 PE=3 SV=1 67 132 4.0E-07
sp|Q9DAJ5|DLRB2_MOUSE Dynein light chain roadblock-type 2 OS=Mus musculus GN=Dynlrb2 PE=1 SV=1 67 132 4.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4263
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7192
Ophiocordyceps australis map64 (Brazil) OphauB2|5719
Ophiocordyceps camponoti-floridani Ophcf2|03463
Ophiocordyceps camponoti-rufipedis Ophun1|5436 (this protein)
Ophiocordyceps kimflemingae Ophio5|2330
Ophiocordyceps subramaniannii Hirsu2|8715

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5436
MIEASMGNGHGTLDEKLSRLSNKPGVRASVVLDRASGAIIKTSGDVSVLGTAKSRDAATAASFTNEVPVAEESET
KGVEDFASLVWNFVKMSGQLVQDMDTEDELRLLRLRTKKQEIVIVPDSKYLLTVIHDTPPA*
Coding >Ophun1|5436
ATGATTGAAGCCTCGATGGGTAACGGCCACGGCACGCTCGACGAGAAGCTCAGTCGACTATCAAACAAGCCCGGA
GTGAGAGCCAGCGTCGTGCTGGACCGAGCCAGTGGAGCAATCATCAAGACCAGCGGCGACGTCTCGGTTCTCGGT
ACTGCCAAGTCCCGCGATGCCGCGACGGCCGCCTCCTTTACCAACGAGGTTCCCGTCGCGGAGGAGAGCGAGACA
AAGGGAGTAGAGGACTTTGCCTCGCTGGTGTGGAACTTTGTCAAAATGTCGGGCCAGTTGGTGCAAGATATGGAC
ACGGAGGACGAGCTGAGGCTTCTGCGACTGCGGACCAAGAAACAGGAGATTGTGATTGTGCCGGATTCCAAGTAT
CTTCTGACGGTTATTCACGACACGCCGCCGGCTTAG
Transcript >Ophun1|5436
ATGATTGAAGCCTCGATGGGTAACGGCCACGGCACGCTCGACGAGAAGCTCAGTCGACTATCAAACAAGCCCGGA
GTGAGAGCCAGCGTCGTGCTGGACCGAGCCAGTGGAGCAATCATCAAGACCAGCGGCGACGTCTCGGTTCTCGGT
ACTGCCAAGTCCCGCGATGCCGCGACGGCCGCCTCCTTTACCAACGAGGTTCCCGTCGCGGAGGAGAGCGAGACA
AAGGGAGTAGAGGACTTTGCCTCGCTGGTGTGGAACTTTGTCAAAATGTCGGGCCAGTTGGTGCAAGATATGGAC
ACGGAGGACGAGCTGAGGCTTCTGCGACTGCGGACCAAGAAACAGGAGATTGTGATTGTGCCGGATTCCAAGTAT
CTTCTGACGGTTATTCACGACACGCCGCCGGCTTAG
Gene >Ophun1|5436
ATGATTGAAGCCTCGATGGTAAAGTCTACAGGCCTTCATTTAAGTACCTCATAACTGACACGTGCCTCCAGGGTA
ACGGCCACGGCACGCTCGACGAGAAGCTCAGTCGACTATCAAACAAGCCCGGAGTGAGAGCCAGCGTCGTGCTGG
ACCGAGCCAGTGGAGCAATCATCAAGACCAGCGGCGACGTCTCGGTTCTCGGTACTGCCAAGTCCCGCGATGCCG
CGACGGCCGCCTCCTTTACCAACGAGGTTCCCGTCGCGGAGGAGAGCGAGACAAAGGGAGTAGAGGACTTTGCCT
CGCTGGTGTGGAACTTTGTCAAAATGTCGGGCCAGTTGGTGCAAGATATGGACACGGAGGTTTGTTCACTTCCTC
GGCGATTAAGGCCCGACTGACGGAGGGCAGGACGAGCTGAGGCTTCTGCGACTGCGGACCAAGAAACAGGAGATT
GTGATTGTGCCGGATTCCAAGTATCTTCTGACGGTTATTCACGACACGCCGCCGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail