Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5432
Gene name
LocationContig_537:9668..10950
Strand+
Gene length (bp)1282
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04479 RTA1 RTA1 like protein 4.5E-57 149 371

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 141 368 7.0E-19
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 141 368 3.0E-18
sp|C7GLH7|RSB1_YEAS2 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RSB1 PE=3 SV=2 141 368 3.0E-18
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 141 368 3.0E-18
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 141 368 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8ZI10|RSB1_YEAS8 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RSB1 PE=3 SV=1 141 368 7.0E-19
sp|B3LJA1|RSB1_YEAS1 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RSB1 PE=3 SV=2 141 368 3.0E-18
sp|C7GLH7|RSB1_YEAS2 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RSB1 PE=3 SV=2 141 368 3.0E-18
sp|A6ZNQ4|RSB1_YEAS7 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RSB1 PE=3 SV=2 141 368 3.0E-18
sp|B5VRU8|RSB1_YEAS6 Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RSB1 PE=3 SV=1 141 368 3.0E-18
sp|Q08417|RSB1_YEAST Sphingoid long-chain base transporter RSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSB1 PE=1 SV=3 141 368 3.0E-18
sp|P40113|RTM1_YEASX Protein RTM1 OS=Saccharomyces cerevisiae GN=RTM1 PE=3 SV=1 149 360 2.0E-15
sp|P53047|RTA1_YEAST Protein RTA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTA1 PE=1 SV=1 108 363 7.0E-13
sp|O13780|YEO2_SCHPO Uncharacterized protein C17G6.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.02c PE=4 SV=1 124 354 9.0E-10
sp|P40100|PUG1_YEAST Protoporphyrin uptake protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUG1 PE=1 SV=1 149 284 1.0E-07
sp|Q12253|YL046_YEAST Uncharacterized membrane protein YLR046C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR046C PE=1 SV=1 141 264 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 114 136 22
2 143 165 22
3 180 202 22
4 226 245 19
5 255 277 22
6 309 331 22
7 341 363 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5432
MADLETPSATSTMADVIPSATETPVAMATDSLVPGDAATVPDMATDGIPPESLPTEVPQDGLPPDGISLDSLPTG
LTPGLPQDLSPDKIQSFCESNPAQMPCASLPGLYQYRINLPANAIFLTLFCLSLIWFCVVLARKRRGALFTLAML
AGLLCEIFGYANRIINFGNQWSVVPFALQFSLITLGPTCMAASIYMCLSRIVSAVGIDNSRIPGDYYTKFFVPCD
IIALLLQAIGGAVTATSVIGGRSADTGNRILIFGIVLQILTLAGFIAAATDFSIRTYRRRKRLGKAAFSHHPAYV
RLRSTMRFRGFVGALALATLCIFCRSVFHLAELSEGIRGPIFANQGLFIFFEGVLIVIAAFALNVMNPIQTTPEL
FPGGGFGLWKKEAAPPPVIIHKVVDWNDKV*
Coding >Ophun1|5432
ATGGCAGACTTGGAAACCCCGAGCGCGACTTCGACCATGGCAGATGTCATTCCCAGCGCCACGGAAACCCCCGTC
GCAATGGCCACCGACTCTCTCGTGCCAGGAGACGCAGCGACGGTGCCGGACATGGCAACGGATGGCATCCCCCCG
GAAAGTCTACCCACCGAAGTGCCTCAGGACGGACTCCCTCCGGACGGCATATCCTTGGACAGTCTCCCCACGGGA
CTTACTCCGGGCCTCCCCCAAGACCTCTCACCAGACAAGATCCAAAGCTTCTGCGAGTCAAATCCAGCACAGATG
CCATGCGCCAGCCTCCCAGGCCTGTACCAGTATCGCATCAACCTACCAGCCAACGCCATCTTCCTAACCCTCTTC
TGCCTCTCGCTGATATGGTTCTGCGTCGTGCTGGCGCGGAAACGGCGCGGGGCCCTCTTCACGCTGGCCATGCTT
GCCGGCTTGCTTTGCGAGATATTCGGATACGCCAACCGCATCATCAACTTTGGCAACCAGTGGAGCGTCGTGCCG
TTTGCCCTGCAGTTCTCGCTCATTACCTTAGGGCCGACGTGTATGGCTGCCAGTATCTACATGTGTCTTAGTCGA
ATCGTCTCCGCCGTTGGCATTGATAACTCACGAATCCCTGGCGACTACTACACCAAATTCTTCGTCCCCTGCGAC
ATCATCGCCCTCCTCCTCCAAGCCATCGGCGGCGCCGTCACAGCCACGTCGGTCATCGGAGGCCGATCCGCTGAC
ACAGGTAACCGGATCCTCATCTTCGGCATCGTGCTGCAGATCCTAACACTAGCCGGCTTCATCGCCGCCGCCACC
GACTTTTCCATCCGCACGTACCGCCGCAGGAAAAGACTGGGAAAGGCGGCTTTCTCGCACCACCCGGCCTATGTC
AGGCTGCGGTCGACGATGCGCTTTCGGGGTTTCGTCGGGGCGCTGGCGCTGGCAACGCTTTGCATCTTTTGCCGG
AGCGTCTTTCACCTTGCCGAGCTCAGCGAGGGTATTAGGGGGCCCATATTTGCTAACCAGGGACTCTTCATCTTC
TTCGAGGGGGTCCTCATTGTTATTGCTGCCTTTGCCCTCAACGTGATGAATCCGATTCAGACGACGCCTGAGCTG
TTTCCCGGCGGTGGTTTTGGGCTGTGGAAGAAGGAGGCCGCGCCGCCGCCGGTGATTATTCACAAGGTGGTGGAC
TGGAATGACAAGGTGTAG
Transcript >Ophun1|5432
ATGGCAGACTTGGAAACCCCGAGCGCGACTTCGACCATGGCAGATGTCATTCCCAGCGCCACGGAAACCCCCGTC
GCAATGGCCACCGACTCTCTCGTGCCAGGAGACGCAGCGACGGTGCCGGACATGGCAACGGATGGCATCCCCCCG
GAAAGTCTACCCACCGAAGTGCCTCAGGACGGACTCCCTCCGGACGGCATATCCTTGGACAGTCTCCCCACGGGA
CTTACTCCGGGCCTCCCCCAAGACCTCTCACCAGACAAGATCCAAAGCTTCTGCGAGTCAAATCCAGCACAGATG
CCATGCGCCAGCCTCCCAGGCCTGTACCAGTATCGCATCAACCTACCAGCCAACGCCATCTTCCTAACCCTCTTC
TGCCTCTCGCTGATATGGTTCTGCGTCGTGCTGGCGCGGAAACGGCGCGGGGCCCTCTTCACGCTGGCCATGCTT
GCCGGCTTGCTTTGCGAGATATTCGGATACGCCAACCGCATCATCAACTTTGGCAACCAGTGGAGCGTCGTGCCG
TTTGCCCTGCAGTTCTCGCTCATTACCTTAGGGCCGACGTGTATGGCTGCCAGTATCTACATGTGTCTTAGTCGA
ATCGTCTCCGCCGTTGGCATTGATAACTCACGAATCCCTGGCGACTACTACACCAAATTCTTCGTCCCCTGCGAC
ATCATCGCCCTCCTCCTCCAAGCCATCGGCGGCGCCGTCACAGCCACGTCGGTCATCGGAGGCCGATCCGCTGAC
ACAGGTAACCGGATCCTCATCTTCGGCATCGTGCTGCAGATCCTAACACTAGCCGGCTTCATCGCCGCCGCCACC
GACTTTTCCATCCGCACGTACCGCCGCAGGAAAAGACTGGGAAAGGCGGCTTTCTCGCACCACCCGGCCTATGTC
AGGCTGCGGTCGACGATGCGCTTTCGGGGTTTCGTCGGGGCGCTGGCGCTGGCAACGCTTTGCATCTTTTGCCGG
AGCGTCTTTCACCTTGCCGAGCTCAGCGAGGGTATTAGGGGGCCCATATTTGCTAACCAGGGACTCTTCATCTTC
TTCGAGGGGGTCCTCATTGTTATTGCTGCCTTTGCCCTCAACGTGATGAATCCGATTCAGACGACGCCTGAGCTG
TTTCCCGGCGGTGGTTTTGGGCTGTGGAAGAAGGAGGCCGCGCCGCCGCCGGTGATTATTCACAAGGTGGTGGAC
TGGAATGACAAGGTGTAG
Gene >Ophun1|5432
ATGGCAGACTTGGAAACCCCGAGCGCGACTTCGACCATGGCAGATGTCATTCCCAGCGCCACGGAAACCCCCGTC
GCAATGGCCACCGACTCTCTCGTGCCAGGAGACGCAGCGACGGTGCCGGACATGGCAACGGATGGCATCCCCCCG
GAAAGTCTACCCACCGAAGTGCCTCAGGACGGACTCCCTCCGGACGGCATATCCTTGGACAGTCTCCCCACGGGA
CTTACTCCGGGCCTCCCCCAAGACCTCTCACCAGACAAGATCCAAAGCTTCTGCGAGTCAAATCCAGCACAGATG
CCATGCGCCAGCCTCCCAGGCCTGTACCAGTATCGCATCAACCTACCAGCCAACGCCATCTTCCTAACCCTCTTC
TGCCTCTCGCTGATATGGTTCTGCGTCGTGCTGGCGCGGAAACGGCGCGGGGCCCTCTTCACGCTGGCCATGCTT
GCCGGCTTGCTTTGCGAGATATTCGGATACGCCAACCGCATCATCAACTTTGGCAACCAGTGGAGCGTCGTGCCG
TTTGCCCTGCAGTTCTCGCTCATTACCTTAGGGCCGACGTGTATGGCTGCCAGTATCTACATGTGTCTTAGTCGA
ATCGTCTCCGCCGTTGGCATTGATAACTCACGAATCCCTGGCGACTACTACACCAAATTCGTGCGTTGTCGTCTT
GGTCCCCCTGTTGTAAATCGAATGGCGGCTGACGTGTACTCTGTGGCAGTTCGTCCCCTGCGACATCATCGCCCT
CCTCCTCCAAGCCATCGGCGGCGCCGTCACAGCCACGTCGGTCATCGGAGGCCGATCCGCTGACACAGGTAACCG
GATCCTCATCTTCGGCATCGTGCTGCAGATCCTAACACTAGCCGGCTTCATCGCCGCCGCCACCGACTTTTCCAT
CCGCACGTACCGCCGCAGGAAAAGACTGGGAAAGGCGGCTTTCTCGCACCACCCGGCCTATGTCAGGCTGCGGTC
GACGATGCGCTTTCGGGGTTTCGTCGGGGCGCTGGCGCTGGCAACGCTTTGCATCTTTTGCCGGAGCGTCTTTCA
CCTTGCCGAGCTCAGCGAGGGTATTAGGGGGCCCATATTTGCTAACCAGGGACTCTTCATCTTCTTCGAGGGGGT
CCTCATTGTTATTGCTGCCTTTGCCCTCAACGTGATGAATCCGATTCAGACGACGCCTGAGCTGTTTCCCGGCGG
TGGTTTTGGGCTGTGGAAGAAGGAGGCCGCGCCGCCGCCGGTGATTATTCACAAGGTGGTGGACTGGAATGACAA
GGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail