Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5417
Gene name
LocationContig_534:10517..12832
Strand+
Gene length (bp)2315
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02185 HR1 Hr1 repeat 1.3E-13 150 214
PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain) 2.9E-12 446 495
PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain) 2.1E-07 514 565
PF00168 C2 C2 domain 2.7E-04 258 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 1 639 0.0E+00
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 1 639 0.0E+00
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 4 617 0.0E+00
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 1 636 0.0E+00
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 4 585 1.0E-161
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 1 639 0.0E+00
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 1 639 0.0E+00
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 4 617 0.0E+00
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 1 636 0.0E+00
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 4 585 1.0E-161
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 8 622 2.0E-150
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 127 587 3.0E-128
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 4 582 2.0E-105
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 362 590 2.0E-20
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 396 649 1.0E-19
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 398 578 2.0E-19
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 362 577 8.0E-19
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 362 588 1.0E-18
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 362 584 1.0E-18
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 343 609 6.0E-17
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 395 622 1.0E-16
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 395 622 1.0E-16
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 419 578 2.0E-16
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 395 622 2.0E-16
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 393 612 3.0E-16
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 393 608 5.0E-16
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 389 592 7.0E-16
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 393 598 2.0E-15
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 427 565 2.0E-15
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 427 566 3.0E-15
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 427 565 3.0E-15
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 427 565 3.0E-15
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 426 564 8.0E-15
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 395 622 8.0E-15
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 427 565 2.0E-14
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 425 565 5.0E-14
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 426 564 5.0E-14
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 425 565 6.0E-14
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 427 564 7.0E-14
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 427 564 7.0E-14
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 427 564 7.0E-14
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 427 564 7.0E-14
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 425 565 7.0E-14
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 427 564 7.0E-14
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 425 565 7.0E-14
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 425 565 7.0E-14
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 425 565 7.0E-14
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 395 615 1.0E-13
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 395 615 1.0E-13
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 412 564 1.0E-13
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 427 564 2.0E-13
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 427 564 3.0E-13
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 395 615 5.0E-13
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 427 564 2.0E-12
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 429 564 6.0E-12
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 429 568 8.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5417
MKDDEAIRSIQAKIEREEALMTAAINMRSLPINEGHRSRIDSELRDNERNIKFFKEKLEAIRQRQVQQDLGSMNL
GEPSGEAPYPPPKDGSAWGDRASYGSHQGGPSMPQRHPFAPPAPGAGMPKPRPNFTKLDLIRYDTPHLGPRIQLM
LSQLQFKLNVEEQYLKGVEKMVQLYGMEGDRKSKADAAGRSIESKQKIVLLKQALKRYEELHVDMDSTDAQDDDS
INTPNLRKPLSGMLTIRCMAVKGVDHAATGRFARGPETFVAVKVEDTVVARTKASRNDRWESEQHTIDVDKGNEI
EVTVYDKPGEHPIPIGMLWVRISDIVEEMRRKRIEAEMNFSGWVSADQHKPASPPPQFPMSPTQGPYVQSSQSQH
LQPGQPGGPGPQPQVSVGPIDGWFNLEPTGQIQLQLSFVKQNKDRRKQDPGLGRKGAVRQRKEEVHEMYGHKFVQ
QQFYNIMRCALCGDFLKYSAGMQCEDCKYTCHTKCYPSVVTKCISKSNAETDPDEEKINHRIPHRFQPFSNMTAN
WCCHCGYILPFGKKNCRKCSECSLTSHAQCVHLVPDFCGMSMAVANQILEGIRIQKQRQAKATSMTDRNLRAGSG
KPGQASSSSHAASASYSGPTPPLYGQAASSEATEAAKLIRVSGGIGGGGGSCKCGNVRVRGRQQQRLRPADARLR
PTQRRLRTSAAPTASTAAL*
Coding >Ophun1|5417
ATGAAGGACGACGAAGCAATCCGCAGCATCCAGGCCAAGATCGAGCGCGAAGAGGCCTTGATGACGGCTGCCATC
AACATGCGGTCGCTGCCCATCAACGAGGGCCATCGCTCCCGCATCGATAGCGAGCTGCGCGACAACGAGCGAAAC
ATCAAGTTCTTCAAGGAGAAGCTCGAGGCCATCCGCCAGCGACAGGTTCAGCAGGACCTCGGCTCCATGAACCTC
GGTGAGCCGTCCGGTGAGGCCCCCTACCCACCTCCCAAGGACGGCTCAGCATGGGGCGACCGCGCCTCGTACGGC
TCCCACCAAGGCGGCCCCTCGATGCCTCAGCGTCACCCCTTTGCGCCTCCGGCCCCCGGCGCCGGCATGCCCAAG
CCCCGACCCAACTTTACCAAGCTTGACCTCATCAGATACGACACGCCGCACCTCGGCCCCCGCATCCAGCTCATG
CTCTCTCAGCTCCAGTTCAAGCTCAACGTCGAGGAGCAGTATCTCAAGGGTGTGGAGAAGATGGTACAGCTCTAT
GGTATGGAGGGTGATCGAAAGAGCAAGGCCGACGCCGCCGGCCGCAGTATCGAGAGCAAGCAGAAGATTGTTCTG
TTGAAGCAGGCGCTCAAGAGATACGAGGAGTTGCACGTTGACATGGACTCGACCGACGCCCAGGATGACGACTCC
ATCAACACACCCAACCTCCGCAAACCCCTGAGCGGCATGCTCACCATCCGCTGCATGGCCGTCAAGGGAGTCGAT
CACGCCGCCACCGGTCGCTTTGCCCGCGGGCCCGAGACCTTTGTGGCTGTCAAGGTGGAGGACACCGTCGTGGCG
CGCACAAAGGCCTCGCGAAACGACCGCTGGGAAAGCGAGCAGCACACCATCGACGTTGACAAGGGCAACGAGATC
GAGGTGACCGTCTACGATAAGCCGGGCGAGCATCCCATCCCCATTGGCATGCTCTGGGTTAGGATATCCGACATC
GTCGAGGAGATGCGCCGCAAGCGCATCGAGGCTGAGATGAACTTTTCCGGCTGGGTCTCGGCCGACCAACACAAG
CCGGCCTCGCCGCCGCCGCAGTTCCCCATGAGCCCGACCCAAGGCCCTTATGTCCAGAGCTCGCAGAGTCAGCAC
CTGCAGCCCGGCCAGCCCGGAGGTCCCGGCCCGCAGCCCCAGGTGTCCGTCGGGCCCATCGACGGCTGGTTCAAC
CTCGAGCCGACGGGCCAGATCCAGCTCCAGCTTAGCTTCGTCAAGCAGAACAAGGACCGGCGCAAACAGGATCCC
GGCCTGGGACGCAAGGGTGCCGTCCGTCAGCGCAAGGAGGAGGTGCACGAGATGTACGGGCACAAGTTCGTCCAG
CAGCAGTTCTACAACATCATGCGCTGCGCGCTCTGCGGAGACTTTCTCAAATACTCGGCCGGCATGCAATGCGAA
GACTGCAAGTACACATGCCACACCAAGTGCTATCCCAGCGTCGTCACCAAGTGCATCAGCAAGAGCAATGCCGAG
ACGGACCCGGACGAGGAGAAGATCAACCACCGGATTCCGCATCGCTTCCAGCCCTTCTCCAACATGACGGCCAAC
TGGTGCTGTCACTGCGGTTATATACTTCCATTTGGTAAAAAGAACTGCAGGAAATGCTCAGAATGCAGCCTCACG
TCCCACGCTCAATGCGTTCACCTGGTACCCGACTTCTGCGGCATGTCCATGGCCGTGGCGAACCAGATCCTCGAG
GGTATCAGGATCCAGAAGCAGCGGCAAGCCAAGGCCACCTCCATGACGGACAGAAACCTGAGGGCTGGCTCCGGC
AAGCCTGGCCAGGCCAGCAGCTCCTCGCACGCGGCTTCGGCCTCTTACTCGGGCCCGACGCCGCCGCTCTACGGC
CAGGCCGCGTCCAGTGAAGCCACCGAGGCGGCCAAGCTCATCCGCGTCTCCGGTGGCATCGGCGGCGGCGGCGGC
AGCTGCAAGTGCGGCAATGTCCGGGTCCGTGGCCGGCAGCAGCAGCGGCTCCGGCCGGCCGACGCCCGACTACGG
CCGACACAGCGGCGGTTACGAACATCAGCAGCACCAACAGCTTCAACAGCAGCATTATGA
Transcript >Ophun1|5417
ATGAAGGACGACGAAGCAATCCGCAGCATCCAGGCCAAGATCGAGCGCGAAGAGGCCTTGATGACGGCTGCCATC
AACATGCGGTCGCTGCCCATCAACGAGGGCCATCGCTCCCGCATCGATAGCGAGCTGCGCGACAACGAGCGAAAC
ATCAAGTTCTTCAAGGAGAAGCTCGAGGCCATCCGCCAGCGACAGGTTCAGCAGGACCTCGGCTCCATGAACCTC
GGTGAGCCGTCCGGTGAGGCCCCCTACCCACCTCCCAAGGACGGCTCAGCATGGGGCGACCGCGCCTCGTACGGC
TCCCACCAAGGCGGCCCCTCGATGCCTCAGCGTCACCCCTTTGCGCCTCCGGCCCCCGGCGCCGGCATGCCCAAG
CCCCGACCCAACTTTACCAAGCTTGACCTCATCAGATACGACACGCCGCACCTCGGCCCCCGCATCCAGCTCATG
CTCTCTCAGCTCCAGTTCAAGCTCAACGTCGAGGAGCAGTATCTCAAGGGTGTGGAGAAGATGGTACAGCTCTAT
GGTATGGAGGGTGATCGAAAGAGCAAGGCCGACGCCGCCGGCCGCAGTATCGAGAGCAAGCAGAAGATTGTTCTG
TTGAAGCAGGCGCTCAAGAGATACGAGGAGTTGCACGTTGACATGGACTCGACCGACGCCCAGGATGACGACTCC
ATCAACACACCCAACCTCCGCAAACCCCTGAGCGGCATGCTCACCATCCGCTGCATGGCCGTCAAGGGAGTCGAT
CACGCCGCCACCGGTCGCTTTGCCCGCGGGCCCGAGACCTTTGTGGCTGTCAAGGTGGAGGACACCGTCGTGGCG
CGCACAAAGGCCTCGCGAAACGACCGCTGGGAAAGCGAGCAGCACACCATCGACGTTGACAAGGGCAACGAGATC
GAGGTGACCGTCTACGATAAGCCGGGCGAGCATCCCATCCCCATTGGCATGCTCTGGGTTAGGATATCCGACATC
GTCGAGGAGATGCGCCGCAAGCGCATCGAGGCTGAGATGAACTTTTCCGGCTGGGTCTCGGCCGACCAACACAAG
CCGGCCTCGCCGCCGCCGCAGTTCCCCATGAGCCCGACCCAAGGCCCTTATGTCCAGAGCTCGCAGAGTCAGCAC
CTGCAGCCCGGCCAGCCCGGAGGTCCCGGCCCGCAGCCCCAGGTGTCCGTCGGGCCCATCGACGGCTGGTTCAAC
CTCGAGCCGACGGGCCAGATCCAGCTCCAGCTTAGCTTCGTCAAGCAGAACAAGGACCGGCGCAAACAGGATCCC
GGCCTGGGACGCAAGGGTGCCGTCCGTCAGCGCAAGGAGGAGGTGCACGAGATGTACGGGCACAAGTTCGTCCAG
CAGCAGTTCTACAACATCATGCGCTGCGCGCTCTGCGGAGACTTTCTCAAATACTCGGCCGGCATGCAATGCGAA
GACTGCAAGTACACATGCCACACCAAGTGCTATCCCAGCGTCGTCACCAAGTGCATCAGCAAGAGCAATGCCGAG
ACGGACCCGGACGAGGAGAAGATCAACCACCGGATTCCGCATCGCTTCCAGCCCTTCTCCAACATGACGGCCAAC
TGGTGCTGTCACTGCGGTTATATACTTCCATTTGGTAAAAAGAACTGCAGGAAATGCTCAGAATGCAGCCTCACG
TCCCACGCTCAATGCGTTCACCTGGTACCCGACTTCTGCGGCATGTCCATGGCCGTGGCGAACCAGATCCTCGAG
GGTATCAGGATCCAGAAGCAGCGGCAAGCCAAGGCCACCTCCATGACGGACAGAAACCTGAGGGCTGGCTCCGGC
AAGCCTGGCCAGGCCAGCAGCTCCTCGCACGCGGCTTCGGCCTCTTACTCGGGCCCGACGCCGCCGCTCTACGGC
CAGGCCGCGTCCAGTGAAGCCACCGAGGCGGCCAAGCTCATCCGCGTCTCCGGTGGCATCGGCGGCGGCGGCGGC
AGCTGCAAGTGCGGCAATGTCCGGGTCCGTGGCCGGCAGCAGCAGCGGCTCCGGCCGGCCGACGCCCGACTACGG
CCGACACAGCGGCGGTTACGAACATCAGCAGCACCAACAGCTTCAACAGCAGCATTATGA
Gene >Ophun1|5417
ATGAAGGACGACGAAGCAATCCGCAGCATCCAGGCCAAGATCGAGCGCGAAGAGGCCTTGATGACGGCTGCCATC
AACATGCGGTCGCTGCCCATCAACGAGGGCCATCGCTCCCGCATCGATAGCGAGCTGCGCGACAACGAGCGAAAC
ATCAAGTTCTTCAAGGAGAAGCTCGAGGCCATCCGCCAGCGACAGGTTCAGCAGGACCTCGGCTCCATGAACCTC
GGTGAGCCGTCCGGTGAGGCCCCCTACCCACCTCCCAAGGACGGCTCAGCATGGGGCGACCGCGCCTCGTACGGC
TCCCACCAAGGCGGCCCCTCGATGCCTCAGCGTCACCCCTTTGCGCCTCCGGCCCCCGGCGCCGGCATGCCCAAG
CCCCGACCCAACTTTACCAAGCTTGGTTTGTCTCCCGGACGTGTCGTCGATGCCTCCTAAGCTGACCCCCGTTCA
GACCTCATCAGATACGACACGCCGCACCTCGGCCCCCGCATCCAGCTCATGCTCTCTCAGCTCCAGTTCAAGCTC
AACGTCGAGGAGCAGTATCTCAAGGGTGTGGAGAAGATGGTACAGCTCTATGGTATGGAGGGTGATCGAAAGAGC
AAGGCCGACGCCGCCGGCCGCAGTATCGAGAGCAAGCAGAAGATTGTTCTGTTGAAGCAGGCGCTCAAGAGATAC
GAGGAGTTGCACGTTGACATGGACTCGACCGACGCCCAGGATGGTAAGTCAGAGATGAGAGAGTGTGAGAGCAGC
GACGTTGACTGACCGCCCCCTAGACGACTCCATCAACACACCCAACCTCCGCAAACCCCTGAGCGGCATGCTCAC
CATCCGCTGCATGGCCGTCAAGGGAGTCGATCACGCCGCCACCGGTCGCTTTGCCCGCGGGCCCGAGACCTTTGT
GGCTGTCAAGGTGGAGGACACCGTCGTGGCGCGCACAAAGGCCTCGCGAAACGACCGCTGGGAAAGCGAGCAGCA
CACCATCGACGTTGACAAGGGCAACGAGATCGAGGTGACCGTCTACGATAAGCCGGGCGAGCATCCCATCCCCAT
TGGCATGCTCTGGGTTAGGATATCCGACATCGTCGAGGAGATGCGCCGCAAGCGCATCGAGGCTGAGATGAACTT
TTCCGGCTGGGTCTCGGCCGACCAACACAAGCCGGCCTCGCCGCCGCCGCAGTTCCCCATGAGCCCGACCCAAGG
CCCTTATGTCCAGAGCTCGCAGAGTCAGCACCTGCAGCCCGGCCAGCCCGGAGGTCCCGGCCCGCAGCCCCAGGT
GTCCGTCGGGCCCATCGACGGCTGGTTCAACCTCGAGCCGACGGGCCAGATCCAGCTCCAGCTTAGCTTCGTCAA
GCAGAACAAGGACCGGCGCAAACAGGATCCCGGCCTGGGACGCAAGGGTGCCGTCCGTCAGCGCAAGGAGGAGGT
GCACGAGATGTACGGGCACAAGTTCGTCCAGCAGCAGTTCTACAACATCATGCGCTGCGCGCTCTGCGGAGACTT
TCTCAAATACTCGGCCGGCATGCAATGCGAAGACTGCAAGTACACATGCCACACCAAGTGCTATCCCAGCGTCGT
CACCAAGTGCATCAGCAAGAGCAATGCCGAGACGGACCCGGACGAGGAGAAGATCAACCACCGGATTCCGCATCG
CTTCCAGCCCTTCTCCAACATGACGGCCAACTGGTGCTGTCACTGCGGTTATATACTTCCATTTGGTAAAAAGAA
CTGCAGGAAATGCTCAGGTAGGTTCCTCCGGTTTGCTTCCGGGCAACATTTGTGGATTGCTGACGGTGTCGGGGA
ACAGAATGCAGCCTCACGTCCCACGCTCAATGCGTTCACCTGGTACCCGACTTCTGCGGCATGTCCATGGCCGTG
GCGAACCAGATCCTCGAGGGTATCAGGATCCAGAAGCAGCGGCAAGCCAAGGCCACCTCCATGACGGACAGAAAC
CTGAGGGCTGGCTCCGGCAAGCCTGGCCAGGCCAGCAGCTCCTCGCACGCGGCTTCGGCCTCTTACTCGGGCCCG
ACGCCGCCGCTCTACGGCCAGGCCGCGTCCAGTGAAGCCACCGAGGCGGCCAAGCTCATGTACGCCAGTCAGACG
TCGCCGCAGCGGCCAACGCAGCCAGCTCGCGCGTCTTCGTCGCAAGCCGCGTCTCCGGTGGCATCGGCGGCGGCG
GCGGCAGCTGCAAGTGCGGCAATGTCCGGGTCCGTGGCCGGCAGCAGCAGCGGCTCCGGCCGGCCGACGCCCGAC
TACGGCCGACACAGCGGCGGTTACGAACATCAGCAGCACCAACAGCTTCAACAGCAGCATTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail