Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5414
Gene name
LocationContig_534:6635..7095
Strand-
Gene length (bp)460
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01176 eIF-1a Translation initiation factor 1A / IF-1 1.8E-15 25 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y803|YN98_SCHPO S1-like domain-containing protein C146.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC146.08c PE=1 SV=1 15 112 2.0E-14
sp|Q8IQ13|EIF1A_DROME Probable RNA-binding protein EIF1AD OS=Drosophila melanogaster GN=CG31957 PE=2 SV=1 20 124 2.0E-10
sp|Q6K1L7|EIF1A_CHICK Probable RNA-binding protein EIF1AD OS=Gallus gallus GN=eif1ad PE=2 SV=1 13 125 3.0E-08
sp|Q7SY07|EIF1A_DANRE Probable RNA-binding protein EIF1AD OS=Danio rerio GN=eif1ad PE=2 SV=1 3 120 4.0E-08
sp|Q58CY2|EIF1A_BOVIN Probable RNA-binding protein EIF1AD OS=Bos taurus GN=EIF1AD PE=2 SV=1 3 118 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y803|YN98_SCHPO S1-like domain-containing protein C146.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC146.08c PE=1 SV=1 15 112 2.0E-14
sp|Q8IQ13|EIF1A_DROME Probable RNA-binding protein EIF1AD OS=Drosophila melanogaster GN=CG31957 PE=2 SV=1 20 124 2.0E-10
sp|Q6K1L7|EIF1A_CHICK Probable RNA-binding protein EIF1AD OS=Gallus gallus GN=eif1ad PE=2 SV=1 13 125 3.0E-08
sp|Q7SY07|EIF1A_DANRE Probable RNA-binding protein EIF1AD OS=Danio rerio GN=eif1ad PE=2 SV=1 3 120 4.0E-08
sp|Q58CY2|EIF1A_BOVIN Probable RNA-binding protein EIF1AD OS=Bos taurus GN=EIF1AD PE=2 SV=1 3 118 1.0E-07
sp|Q4R354|EIF1A_MACFA Probable RNA-binding protein EIF1AD OS=Macaca fascicularis GN=EIF1AD PE=2 SV=1 3 134 3.0E-07
sp|Q8N9N8|EIF1A_HUMAN Probable RNA-binding protein EIF1AD OS=Homo sapiens GN=EIF1AD PE=1 SV=1 3 134 3.0E-07
sp|Q5HZM1|EIF1A_XENLA Probable RNA-binding protein EIF1AD OS=Xenopus laevis GN=eif1ad PE=2 SV=1 25 125 3.0E-07
sp|Q5RD29|EIF1A_PONAB Probable RNA-binding protein EIF1AD OS=Pongo abelii GN=EIF1AD PE=2 SV=1 3 108 4.0E-07
sp|Q3THJ3|EIF1A_MOUSE Probable RNA-binding protein EIF1AD OS=Mus musculus GN=Eif1ad PE=1 SV=2 3 108 4.0E-07
sp|Q29MZ0|EIF1A_DROPS Probable RNA-binding protein EIF1AD OS=Drosophila pseudoobscura pseudoobscura GN=GA16587 PE=3 SV=1 26 116 5.0E-07
sp|Q0V9J5|EIF1A_XENTR Probable RNA-binding protein EIF1AD OS=Xenopus tropicalis GN=eif1ad PE=2 SV=1 25 113 5.0E-07
sp|Q5RKI6|EIF1A_RAT Probable RNA-binding protein EIF1AD OS=Rattus norvegicus GN=Eif1ad PE=1 SV=1 3 108 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003743 translation initiation factor activity Yes
GO:0003723 RNA binding Yes
GO:0006413 translational initiation Yes
GO:0097159 organic cyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0003674 molecular_function No
GO:0008135 translation factor activity, RNA binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0045182 translation regulator activity No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5414
MGRSKRSVLAAAEESLTPPDSLLPNQFVARVIKPEGNNLYACELSSKKLMVLELAQRFRNTIWIKRGGFILAQSY
DGGDGDARPAGEIVNVVRDEKLWRKQPYWPKEFVKSSTYDAADDGDDSNVGKMPHSDSEDE*
Coding >Ophun1|5414
ATGGGCCGGTCGAAGCGAAGCGTCCTCGCGGCGGCAGAAGAGTCCCTGACTCCACCGGATTCGTTACTGCCCAAC
CAGTTCGTCGCCCGTGTGATCAAGCCCGAGGGCAACAACCTATACGCCTGCGAGCTCTCGAGCAAGAAGTTGATG
GTCTTGGAGCTCGCTCAGCGATTCCGCAACACCATTTGGATCAAGCGCGGTGGCTTCATCCTCGCTCAAAGCTAC
GACGGGGGCGATGGTGATGCGCGACCCGCCGGGGAGATTGTCAATGTTGTGCGCGACGAGAAGCTGTGGCGGAAG
CAGCCGTACTGGCCCAAGGAATTTGTCAAGTCTTCGACGTACGATGCAGCCGACGACGGTGATGATTCCAATGTC
GGCAAGATGCCGCATAGCGATTCGGAGGATGAGTGA
Transcript >Ophun1|5414
ATGGGCCGGTCGAAGCGAAGCGTCCTCGCGGCGGCAGAAGAGTCCCTGACTCCACCGGATTCGTTACTGCCCAAC
CAGTTCGTCGCCCGTGTGATCAAGCCCGAGGGCAACAACCTATACGCCTGCGAGCTCTCGAGCAAGAAGTTGATG
GTCTTGGAGCTCGCTCAGCGATTCCGCAACACCATTTGGATCAAGCGCGGTGGCTTCATCCTCGCTCAAAGCTAC
GACGGGGGCGATGGTGATGCGCGACCCGCCGGGGAGATTGTCAATGTTGTGCGCGACGAGAAGCTGTGGCGGAAG
CAGCCGTACTGGCCCAAGGAATTTGTCAAGTCTTCGACGTACGATGCAGCCGACGACGGTGATGATTCCAATGTC
GGCAAGATGCCGCATAGCGATTCGGAGGATGAGTGA
Gene >Ophun1|5414
ATGGGCCGGTCGAAGCGAAGCGTCCTCGCGGCGGCAGAAGAGTCCCTGACTCCACCGGATTCGTTACTGCCCAAC
CAGTTCGTCGCCCGTGTGATCAAGCCCGAGGGCAACAACCTATACGCCTGCGAGCTCTCGAGCAAGAAGTTGATG
GTCTTGGAGCTCGCTCAGCGATTCCGCAACACCATTTGGATCAAGCGCGGTGGCTTCATCCTCGCTCAAAGCTAC
GACGGGGGCGATGGTGATGCGCGACCCGCCGGGGAGATTGTCAATGTTGTGCGCGACGAGAAGCTGTGGCGGAAG
CAGCCGTACTGGTATGGCTTCGTCCTGTTGATGAGCCGCTCAGACGCTCACGAGTCCAAGGCCCAAGGAATTTGT
CAAGTCTTCGACGTACGATGCAGCCGACGACGGTGATGATTCCAATGTCGGCAAGATGCCGCATAGCGATTCGGA
GGATGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail