Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5413
Gene name
LocationContig_534:5225..6624
Strand+
Gene length (bp)1399
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05208 ALG3 ALG3 protein 6.2E-145 30 393

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1K8|ALG3_NEUCR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-3 PE=3 SV=1 7 394 0.0E+00
sp|Q2U6A4|ALG3_ASPOR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg3 PE=3 SV=1 20 420 1.0E-140
sp|A1DDZ3|ALG3_NEOFI Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alg3 PE=3 SV=1 20 424 2.0E-138
sp|Q4WVG2|ALG3_ASPFU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg3 PE=3 SV=1 20 424 2.0E-135
sp|A1CBE6|ALG3_ASPCL Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alg3 PE=3 SV=1 20 404 1.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1K8|ALG3_NEUCR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-3 PE=3 SV=1 7 394 0.0E+00
sp|Q2U6A4|ALG3_ASPOR Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg3 PE=3 SV=1 20 420 1.0E-140
sp|A1DDZ3|ALG3_NEOFI Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alg3 PE=3 SV=1 20 424 2.0E-138
sp|Q4WVG2|ALG3_ASPFU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alg3 PE=3 SV=1 20 424 2.0E-135
sp|A1CBE6|ALG3_ASPCL Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alg3 PE=3 SV=1 20 404 1.0E-127
sp|A2RA94|ALG3_ASPNC Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=alg3 PE=3 SV=1 20 420 7.0E-104
sp|Q9Y7I4|ALG3_SCHPO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg3 PE=3 SV=1 31 408 2.0E-95
sp|Q0TVF9|ALG3_PHANO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ALG3 PE=3 SV=2 29 326 7.0E-94
sp|P0CN93|ALG3_CRYNB Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG3 PE=3 SV=1 31 424 2.0E-88
sp|P0CN92|ALG3_CRYNJ Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG3 PE=3 SV=1 31 424 3.0E-88
sp|O82244|ALG3_ARATH Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Arabidopsis thaliana GN=ALG3 PE=1 SV=1 30 394 9.0E-82
sp|A3LTB7|ALG3_PICST Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ALG3 PE=3 SV=2 15 420 2.0E-81
sp|Q55F69|ALG3_DICDI Probable Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Dictyostelium discoideum GN=alg3 PE=3 SV=1 20 393 2.0E-80
sp|Q6CMF1|ALG3_KLULA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG3 PE=3 SV=1 24 418 6.0E-77
sp|Q92685|ALG3_HUMAN Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Homo sapiens GN=ALG3 PE=1 SV=1 27 422 2.0E-74
sp|Q751K5|ALG3_ASHGO Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG3 PE=3 SV=2 24 394 4.0E-74
sp|P38179|ALG3_YEAST Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG3 PE=1 SV=1 27 393 6.0E-74
sp|Q8K2A8|ALG3_MOUSE Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Mus musculus GN=Alg3 PE=1 SV=2 27 422 3.0E-71
sp|Q6BYY8|ALG3_DEBHA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG3 PE=3 SV=1 27 413 5.0E-71
sp|Q6DNA2|ALG3_PICPG Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ALG3 PE=3 SV=2 23 394 4.0E-69
sp|A5DJQ5|ALG3_PICGU Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ALG3 PE=3 SV=2 15 410 7.0E-67
sp|Q6FXS2|ALG3_CANGA Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG3 PE=3 SV=1 24 393 6.0E-66
sp|Q24332|NT56_DROVI Lethal(2)neighbour of Tid protein OS=Drosophila virilis GN=l(2)not PE=1 SV=1 33 289 9.0E-57
sp|P82149|NT53_DROME Lethal(2)neighbour of tid protein 2 OS=Drosophila melanogaster GN=l(2)not2 PE=2 SV=1 33 289 2.0E-52
sp|Q27333|NT56_DROME Lethal(2)neighbour of tid protein OS=Drosophila melanogaster GN=l(2)not PE=1 SV=1 33 272 3.0E-52
sp|Q27333|NT56_DROME Lethal(2)neighbour of tid protein OS=Drosophila melanogaster GN=l(2)not PE=1 SV=1 335 420 5.0E-06
sp|Q24332|NT56_DROVI Lethal(2)neighbour of Tid protein OS=Drosophila virilis GN=l(2)not PE=1 SV=1 335 393 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000030 mannosyltransferase activity Yes
GO:0016757 glycosyltransferase activity No
GO:0003674 molecular_function No
GO:0016758 hexosyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 103 125 22
3 147 169 22
4 182 204 22
5 214 231 17
6 268 290 22
7 327 346 19
8 353 375 22
9 390 412 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5413
MSRLQVKSLWRFTVDVAAGRHALSSFVAPALWLLDAALCCLVIWRVPYTEIDWVAYMEQVTQFLSGERDYAKIEG
GTGPLVYPAAHVYIYSGLYHLTNRGENILLAQKLFAGLYLATLALVMLCYRRAKAPPYLLVLLVLSKRLHSVFML
RCFNDCFAVFFLWLAIFLLQRRLWTLGALSYSLGLGVKMSLLLVLPAVAVVLFLGRGFDGSLHTAWLMALLQLAI
AVPFLAADWKSYLGRAFELSRQFKFEWTVNWRMVGEQMFLSKSFAISLLALHAAVLVLFIATRWMKPTGRRLSTM
IPALLRGRSPFAPLEELAVSRRITPEYVMTAVLSANVIGLLFARSLHYQFYAYLYWSSPYLLWVASPHPLFIVPV
WLAQEWAWNVFPSTTASSSVVVGVLAVTVGSVYLRTAEVDDSEERIRLRANKNE*
Coding >Ophun1|5413
ATGTCGCGCCTCCAAGTCAAAAGCCTGTGGCGCTTCACCGTCGATGTCGCCGCCGGCCGTCACGCCCTCTCGAGC
TTCGTCGCGCCCGCGCTCTGGCTGCTCGACGCGGCGCTGTGCTGCCTCGTCATCTGGAGGGTGCCATATACCGAA
ATCGACTGGGTCGCGTATATGGAGCAGGTGACCCAGTTCCTCTCCGGCGAGCGCGACTACGCAAAGATAGAGGGC
GGCACCGGCCCCCTCGTCTACCCAGCTGCACATGTCTACATCTATTCGGGTCTCTATCATCTGACGAATCGCGGA
GAGAATATTCTGCTTGCCCAGAAGCTCTTTGCCGGTCTCTATCTGGCGACACTCGCCCTGGTGATGCTGTGCTAT
CGGCGCGCCAAGGCACCGCCGTATCTGCTCGTCCTTCTGGTTCTTTCGAAGCGCCTGCACAGCGTCTTCATGCTG
CGTTGCTTCAATGACTGCTTCGCCGTCTTTTTCCTCTGGCTCGCCATCTTCCTGCTTCAGCGCAGGCTATGGACC
CTCGGCGCCTTGTCTTACAGTTTGGGGCTCGGCGTCAAAATGTCGCTGCTACTGGTTCTTCCGGCTGTTGCCGTC
GTTCTCTTCCTCGGACGGGGCTTTGACGGAAGCCTGCACACAGCCTGGCTGATGGCGCTCTTGCAGCTCGCTATA
GCTGTGCCATTCCTCGCCGCGGACTGGAAGTCATATTTGGGGAGAGCATTCGAGCTGTCACGGCAATTCAAGTTC
GAGTGGACGGTCAATTGGCGAATGGTGGGGGAACAAATGTTCCTCAGCAAGTCCTTTGCCATATCACTGCTCGCT
CTTCATGCGGCAGTCCTGGTGCTCTTCATCGCGACGAGATGGATGAAGCCCACAGGCCGGCGTTTGTCGACCATG
ATCCCTGCCCTGCTCCGCGGTCGATCCCCCTTCGCGCCGCTTGAGGAGCTCGCCGTGTCCAGACGCATCACGCCC
GAATACGTCATGACGGCCGTACTGTCGGCCAACGTTATCGGATTGCTATTCGCCCGCTCCCTTCATTACCAGTTC
TACGCCTACCTGTACTGGTCTTCACCGTACTTACTGTGGGTAGCTTCACCTCATCCGCTCTTCATCGTGCCTGTT
TGGCTGGCACAAGAATGGGCCTGGAACGTCTTCCCGAGCACCACTGCCAGCTCGTCTGTCGTGGTTGGTGTTCTC
GCCGTCACGGTCGGTTCGGTTTATCTGAGAACCGCGGAAGTGGATGATTCGGAAGAGCGGATAAGGCTGAGAGCC
AACAAGAACGAGTAA
Transcript >Ophun1|5413
ATGTCGCGCCTCCAAGTCAAAAGCCTGTGGCGCTTCACCGTCGATGTCGCCGCCGGCCGTCACGCCCTCTCGAGC
TTCGTCGCGCCCGCGCTCTGGCTGCTCGACGCGGCGCTGTGCTGCCTCGTCATCTGGAGGGTGCCATATACCGAA
ATCGACTGGGTCGCGTATATGGAGCAGGTGACCCAGTTCCTCTCCGGCGAGCGCGACTACGCAAAGATAGAGGGC
GGCACCGGCCCCCTCGTCTACCCAGCTGCACATGTCTACATCTATTCGGGTCTCTATCATCTGACGAATCGCGGA
GAGAATATTCTGCTTGCCCAGAAGCTCTTTGCCGGTCTCTATCTGGCGACACTCGCCCTGGTGATGCTGTGCTAT
CGGCGCGCCAAGGCACCGCCGTATCTGCTCGTCCTTCTGGTTCTTTCGAAGCGCCTGCACAGCGTCTTCATGCTG
CGTTGCTTCAATGACTGCTTCGCCGTCTTTTTCCTCTGGCTCGCCATCTTCCTGCTTCAGCGCAGGCTATGGACC
CTCGGCGCCTTGTCTTACAGTTTGGGGCTCGGCGTCAAAATGTCGCTGCTACTGGTTCTTCCGGCTGTTGCCGTC
GTTCTCTTCCTCGGACGGGGCTTTGACGGAAGCCTGCACACAGCCTGGCTGATGGCGCTCTTGCAGCTCGCTATA
GCTGTGCCATTCCTCGCCGCGGACTGGAAGTCATATTTGGGGAGAGCATTCGAGCTGTCACGGCAATTCAAGTTC
GAGTGGACGGTCAATTGGCGAATGGTGGGGGAACAAATGTTCCTCAGCAAGTCCTTTGCCATATCACTGCTCGCT
CTTCATGCGGCAGTCCTGGTGCTCTTCATCGCGACGAGATGGATGAAGCCCACAGGCCGGCGTTTGTCGACCATG
ATCCCTGCCCTGCTCCGCGGTCGATCCCCCTTCGCGCCGCTTGAGGAGCTCGCCGTGTCCAGACGCATCACGCCC
GAATACGTCATGACGGCCGTACTGTCGGCCAACGTTATCGGATTGCTATTCGCCCGCTCCCTTCATTACCAGTTC
TACGCCTACCTGTACTGGTCTTCACCGTACTTACTGTGGGTAGCTTCACCTCATCCGCTCTTCATCGTGCCTGTT
TGGCTGGCACAAGAATGGGCCTGGAACGTCTTCCCGAGCACCACTGCCAGCTCGTCTGTCGTGGTTGGTGTTCTC
GCCGTCACGGTCGGTTCGGTTTATCTGAGAACCGCGGAAGTGGATGATTCGGAAGAGCGGATAAGGCTGAGAGCC
AACAAGAACGAGTAA
Gene >Ophun1|5413
ATGTCGCGCCTCCAAGTCAAAAGCCTGTGGCGCTTCACCGTCGATGTCGCCGCCGGCCGTCACGCCCTCTCGAGC
TTCGTCGCGCCCGCGCTCTGGCTGCTCGACGCGGCGCTGTGCTGCCTCGTCATCTGGAGGGTGCCATGTCCGTCT
CTTCTCAATATGCAATCACGATCAGTTTCTGACATTGCGTCTGCAGATACCGAAATCGACTGGGTCGCGTATATG
GAGCAGGTGACCCAGTTCCTCTCCGGCGAGCGCGACTACGCAAAGATAGAGGGCGGCACCGGCCCCCTCGTCTAC
CCAGCTGCACATGTCTACATCTATTCGGGTCTCTATCATCTGACGAATCGCGGAGAGAATATTCTGCTTGCCCAG
AAGCTCTTTGCCGGTCTCTATCTGGCGACACTCGCCCTGGTGATGCTGTGCTATCGGCGCGCCAAGGTAGGCCAG
CATTCGATCACGCTGGTGGACAGGCTGCTCTAATAACGAGCCGCAGGCACCGCCGTATCTGCTCGTCCTTCTGGT
TCTTTCGAAGCGCCTGCACAGCGTCTTCATGCTGCGTTGCTTCAATGACTGCTTCGCCGTCTTTTTCCTCTGGCT
CGCCATCTTCCTGCTTCAGCGCAGGCTATGGACCCTCGGCGCCTTGTCTTACAGTTTGGGGCTCGGCGTCAAAAT
GTCGCTGCTACTGGTTCTTCCGGCTGTTGCCGTCGTTCTCTTCCTCGGACGGGGCTTTGACGGAAGCCTGCACAC
AGCCTGGCTGATGGCGCTCTTGCAGCTCGCTATAGCTGTGCCATTCCTCGCCGCGGACTGGAAGTCATATTTGGG
GAGAGCATTCGAGCTGTCACGGCAATTCAAGTTCGAGTGGACGGTCAATTGGCGAATGGTGGGGGAACAAATGTT
CCTCAGCAAGTCCTTTGCCATATCACTGCTCGCTCTTCATGCGGCAGTCCTGGTGCTCTTCATCGCGACGAGATG
GATGAAGCCCACAGGCCGGCGTTTGTCGACCATGATCCCTGCCCTGCTCCGCGGTCGATCCCCCTTCGCGCCGCT
TGAGGAGCTCGCCGTGTCCAGACGCATCACGCCCGAATACGTCATGACGGCCGTACTGTCGGCCAACGTTATCGG
ATTGCTATTCGCCCGCTCCCTTCATTACCAGTTCTACGCCTACCTGTACTGGTCTTCACCGTACTTACTGTGGGT
AGCTTCACCTCATCCGCTCTTCATCGTGCCTGTTTGGCTGGCACAAGAATGGGCCTGGAACGTCTTCCCGAGCAC
CACTGCCAGCTCGTCTGTCGTGGTTGGTGTTCTCGCCGTCACGGTCGGTTCGGTTTATCTGAGAACCGCGGAAGT
GGATGATTCGGAAGAGCGGATAAGGCTGAGAGCCAACAAGAACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail