Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5411
Gene name
LocationContig_533:9809..12510
Strand+
Gene length (bp)2701
Transcript length (bp)2142
Coding sequence length (bp)2142
Protein length (aa) 714

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03463 eRF1_1 eRF1 domain 1 2.2E-37 1 131
PF00248 Aldo_ket_red Aldo/keto reductase family 9.1E-27 449 694
PF03464 eRF1_2 eRF1 domain 2 7.0E-19 140 264
PF03465 eRF1_3 eRF1 domain 3 4.2E-17 273 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XIP1|PELO_RAT Protein pelota homolog OS=Rattus norvegicus GN=Pelo PE=1 SV=1 1 384 2.0E-87
sp|Q58DV0|PELO_BOVIN Protein pelota homolog OS=Bos taurus GN=PELO PE=2 SV=2 1 385 6.0E-87
sp|Q5RCE3|PELO_PONAB Protein pelota homolog OS=Pongo abelii GN=PELO PE=2 SV=1 1 384 7.0E-87
sp|Q7ZWC4|PELO_DANRE Protein pelota homolog OS=Danio rerio GN=pelo PE=2 SV=1 1 384 3.0E-86
sp|Q9BRX2|PELO_HUMAN Protein pelota homolog OS=Homo sapiens GN=PELO PE=1 SV=2 1 383 3.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XIP1|PELO_RAT Protein pelota homolog OS=Rattus norvegicus GN=Pelo PE=1 SV=1 1 384 2.0E-87
sp|Q58DV0|PELO_BOVIN Protein pelota homolog OS=Bos taurus GN=PELO PE=2 SV=2 1 385 6.0E-87
sp|Q5RCE3|PELO_PONAB Protein pelota homolog OS=Pongo abelii GN=PELO PE=2 SV=1 1 384 7.0E-87
sp|Q7ZWC4|PELO_DANRE Protein pelota homolog OS=Danio rerio GN=pelo PE=2 SV=1 1 384 3.0E-86
sp|Q9BRX2|PELO_HUMAN Protein pelota homolog OS=Homo sapiens GN=PELO PE=1 SV=2 1 383 3.0E-86
sp|P48612|PELO_DROME Protein pelota OS=Drosophila melanogaster GN=pelo PE=2 SV=2 17 376 4.0E-86
sp|Q80X73|PELO_MOUSE Protein pelota homolog OS=Mus musculus GN=Pelo PE=1 SV=3 1 384 5.0E-86
sp|Q5ZK01|PELO_CHICK Protein pelota homolog OS=Gallus gallus GN=PELO PE=2 SV=1 1 384 7.0E-86
sp|Q9USL5|DOM34_SCHPO Protein dom34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dom34 PE=1 SV=1 17 376 1.0E-84
sp|Q5U567|PELO_XENLA Protein pelota homolog OS=Xenopus laevis GN=pelo PE=2 SV=1 1 379 1.0E-82
sp|P50444|PELO_CAEEL Protein pelota homolog OS=Caenorhabditis elegans GN=R74.6 PE=3 SV=1 17 386 9.0E-69
sp|Q9ZT87|PEL1_ARATH Protein PELOTA 1 OS=Arabidopsis thaliana GN=PEL1 PE=2 SV=1 1 381 1.0E-65
sp|O14088|YER5_SCHPO Uncharacterized oxidoreductase C2F3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.05c PE=3 SV=1 428 711 5.0E-62
sp|Q9M2H7|PEL2_ARATH Protein PELOTA 2 OS=Arabidopsis thaliana GN=PEL2 PE=3 SV=1 1 381 2.0E-57
sp|Q9C1X5|YKW2_SCHPO Uncharacterized oxidoreductase P32A8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.02 PE=3 SV=1 422 708 1.0E-53
sp|P33309|DOM34_YEAST Protein DOM34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOM34 PE=1 SV=2 17 386 1.0E-51
sp|O32210|GR_BACSU Glyoxal reductase OS=Bacillus subtilis (strain 168) GN=yvgN PE=1 SV=1 427 698 7.0E-49
sp|A0QV10|Y2408_MYCS2 Uncharacterized oxidoreductase MSMEG_2408/MSMEI_2347 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2408 PE=1 SV=1 422 698 2.0E-48
sp|P47137|YJ66_YEAST Uncharacterized oxidoreductase YJR096W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR096W PE=1 SV=1 422 710 1.0E-47
sp|Q8ZI40|DKGA_YERPE 2,5-diketo-D-gluconic acid reductase A OS=Yersinia pestis GN=dkgA PE=3 SV=1 426 695 1.0E-46
sp|Q46857|DKGA_ECOLI 2,5-diketo-D-gluconic acid reductase A OS=Escherichia coli (strain K12) GN=dkgA PE=1 SV=3 430 691 6.0E-45
sp|Q9GV41|PGFS_TRYBB Prostaglandin F synthase OS=Trypanosoma brucei brucei PE=1 SV=1 426 694 1.0E-44
sp|Q8XBT6|DKGA_ECO57 2,5-diketo-D-gluconic acid reductase A OS=Escherichia coli O157:H7 GN=dkgA PE=3 SV=1 430 691 3.0E-44
sp|A4TE41|Y4205_MYCGI Uncharacterized oxidoreductase Mflv_4205 OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_4205 PE=3 SV=1 431 696 3.0E-44
sp|A1T726|Y2161_MYCVP Uncharacterized oxidoreductase Mvan_2161 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=Mvan_2161 PE=3 SV=1 431 694 2.0E-43
sp|A1UEC5|Y1984_MYCSK Uncharacterized oxidoreductase Mkms_1984 OS=Mycobacterium sp. (strain KMS) GN=Mkms_1984 PE=3 SV=1 431 686 2.0E-43
sp|Q1BAN7|Y1938_MYCSS Uncharacterized oxidoreductase Mmcs_1938 OS=Mycobacterium sp. (strain MCS) GN=Mmcs_1938 PE=3 SV=1 431 686 2.0E-43
sp|A3PXS9|Y1918_MYCSJ Uncharacterized oxidoreductase Mjls_1918 OS=Mycobacterium sp. (strain JLS) GN=Mjls_1918 PE=3 SV=1 431 686 1.0E-42
sp|Q7TXI6|Y2996_MYCBO Uncharacterized oxidoreductase Mb2996 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2996 PE=1 SV=1 429 694 4.0E-42
sp|A1KMW6|Y2993_MYCBP Uncharacterized oxidoreductase BCG_2993 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2993 PE=3 SV=1 429 694 4.0E-42
sp|P06632|DKGA_CORSC 2,5-diketo-D-gluconic acid reductase A OS=Corynebacterium sp. (strain ATCC 31090) GN=dkgA PE=1 SV=3 426 694 6.0E-42
sp|A3PXT0|Y1919_MYCSJ Uncharacterized oxidoreductase Mjls_1919 OS=Mycobacterium sp. (strain JLS) GN=Mjls_1919 PE=3 SV=1 432 698 7.0E-42
sp|A1UEC6|Y1985_MYCSK Uncharacterized oxidoreductase Mkms_1985 OS=Mycobacterium sp. (strain KMS) GN=Mkms_1985 PE=3 SV=1 432 698 3.0E-41
sp|A5U6Y1|Y2999_MYCTA Uncharacterized oxidoreductase MRA_2999 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2999 PE=3 SV=1 429 694 3.0E-41
sp|P9WQA5|Y2971_MYCTU Uncharacterized oxidoreductase Rv2971 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2971 PE=1 SV=1 429 694 3.0E-41
sp|P9WQA4|Y2971_MYCTO Uncharacterized oxidoreductase MT3049 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3049 PE=3 SV=1 429 694 3.0E-41
sp|O34678|YTBE_BACSU Uncharacterized oxidoreductase YtbE OS=Bacillus subtilis (strain 168) GN=ytbE PE=1 SV=1 428 691 8.0E-41
sp|P22045|PGFS_LEIMA Prostaglandin F synthase OS=Leishmania major GN=P100/11E PE=1 SV=3 430 701 8.0E-41
sp|P87039|XYL2_CANTR NADPH-dependent D-xylose reductase II,III OS=Candida tropicalis GN=xyrB PE=1 SV=1 431 705 2.0E-40
sp|A0QV09|Y2407_MYCS2 Uncharacterized oxidoreductase MSMEG_2407/MSMEI_2346 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_2407 PE=1 SV=1 431 694 3.0E-40
sp|O69462|Y1669_MYCLE Uncharacterized oxidoreductase ML1669 OS=Mycobacterium leprae (strain TN) GN=ML1669 PE=3 SV=1 424 694 7.0E-39
sp|B8ZS00|Y1669_MYCLB Uncharacterized oxidoreductase MLBr01669 OS=Mycobacterium leprae (strain Br4923) GN=MLBr01669 PE=3 SV=1 424 694 7.0E-39
sp|O94735|XYL1_PICGU NADPH-dependent D-xylose reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=XYL1 PE=1 SV=2 431 705 8.0E-39
sp|O13283|XYL1_CANTR NAD(P)H-dependent D-xylose reductase I,II OS=Candida tropicalis GN=xyrA PE=3 SV=1 431 705 9.0E-39
sp|Q12458|YPR1_YEAST Putative reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR1 PE=1 SV=1 429 682 2.0E-38
sp|P70694|DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus GN=Akr1c6 PE=1 SV=1 431 694 8.0E-38
sp|Q76L36|CPRC2_CANPA NADPH-dependent conjugated polyketone reductase C2 OS=Candida parapsilosis GN=cpr-c2 PE=1 SV=1 428 691 9.0E-38
sp|P05980|PGFS1_BOVIN Prostaglandin F synthase 1 OS=Bos taurus PE=1 SV=3 422 694 1.0E-37
sp|P31867|XYL1_PICST NAD(P)H-dependent D-xylose reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=XYL1 PE=1 SV=1 431 690 1.0E-37
sp|Q8ZM06|DKGA_SALTY 2,5-diketo-D-gluconic acid reductase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dkgA PE=3 SV=1 430 691 2.0E-37
sp|P52897|PGFS2_BOVIN Prostaglandin F synthase 2 OS=Bos taurus PE=2 SV=1 422 694 3.0E-37
sp|P58744|DKGA_SALTI Putative 2,5-diketo-D-gluconic acid reductase A OS=Salmonella typhi GN=dkgA PE=5 SV=2 430 691 3.0E-37
sp|O60218|AK1BA_HUMAN Aldo-keto reductase family 1 member B10 OS=Homo sapiens GN=AKR1B10 PE=1 SV=2 428 686 3.0E-37
sp|P51635|AK1A1_RAT Alcohol dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Akr1a1 PE=1 SV=2 429 694 4.0E-37
sp|Q5R5D5|AK1A1_PONAB Alcohol dehydrogenase [NADP(+)] OS=Pongo abelii GN=AKR1A1 PE=2 SV=1 429 695 5.0E-37
sp|Q5BGA7|XYL1_EMENI Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xyl1 PE=3 SV=1 431 695 5.0E-37
sp|A0QJ99|Y3816_MYCA1 Uncharacterized oxidoreductase MAV_3816 OS=Mycobacterium avium (strain 104) GN=MAV_3816 PE=3 SV=2 431 694 1.0E-36
sp|Q9P430|XYL1_SCHSH NAD(P)H-dependent D-xylose reductase OS=Scheffersomyces shehatae GN=XYL1 PE=3 SV=1 433 705 1.0E-36
sp|P14550|AK1A1_HUMAN Alcohol dehydrogenase [NADP(+)] OS=Homo sapiens GN=AKR1A1 PE=1 SV=3 429 695 4.0E-36
sp|B2HIJ9|Y1744_MYCMM Uncharacterized oxidoreductase MMAR_1744 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=MMAR_1744 PE=3 SV=1 431 694 7.0E-36
sp|A0PQ11|Y1987_MYCUA Uncharacterized oxidoreductase MUL_1987 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_1987 PE=3 SV=1 414 694 8.0E-36
sp|Q9JII6|AK1A1_MOUSE Alcohol dehydrogenase [NADP(+)] OS=Mus musculus GN=Akr1a1 PE=1 SV=3 429 694 9.0E-36
sp|Q73VK6|Y3007_MYCPA Uncharacterized oxidoreductase MAP_3007 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_3007 PE=3 SV=1 431 694 1.0E-35
sp|Q6IMN8|ALRA_DICDI Aldose reductase A OS=Dictyostelium discoideum GN=alrA PE=2 SV=1 428 691 1.0E-35
sp|Q9USV2|YHH5_SCHPO Uncharacterized oxidoreductase C28F2.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC28F2.05c PE=3 SV=1 436 710 1.0E-35
sp|Q3ZCJ2|AK1A1_BOVIN Alcohol dehydrogenase [NADP(+)] OS=Bos taurus GN=AKR1A1 PE=2 SV=1 429 694 1.0E-35
sp|P50578|AK1A1_PIG Alcohol dehydrogenase [NADP(+)] OS=Sus scrofa GN=AKR1A1 PE=1 SV=2 429 694 2.0E-35
sp|Q5R7C9|AK1C3_PONAB Aldo-keto reductase family 1 member C3 homolog OS=Pongo abelii GN=AKR1C3 PE=2 SV=1 431 694 3.0E-35
sp|Q2UKD0|XYL1_ASPOR Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xyl1 PE=3 SV=1 429 696 4.0E-35
sp|B8N195|XYL1_ASPFN Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xyl1 PE=3 SV=1 429 696 4.0E-35
sp|Q95JH6|AK1C1_MACFU Aldo-keto reductase family 1 member C1 homolog OS=Macaca fuscata fuscata GN=AKR1C1 PE=2 SV=1 430 694 1.0E-34
sp|O74237|XYL1_CANTE NAD(P)H-dependent D-xylose reductase OS=Candida tenuis GN=XYL1 PE=1 SV=1 432 705 1.0E-34
sp|Q6AZW2|A1A1A_DANRE Alcohol dehydrogenase [NADP(+)] A OS=Danio rerio GN=akr1a1a PE=2 SV=2 428 696 2.0E-34
sp|P42330|AK1C3_HUMAN Aldo-keto reductase family 1 member C3 OS=Homo sapiens GN=AKR1C3 PE=1 SV=4 431 694 2.0E-34
sp|Q95JH7|AK1C1_MACFA Aldo-keto reductase family 1 member C1 homolog OS=Macaca fascicularis GN=AKR1C1 PE=1 SV=1 430 694 3.0E-34
sp|B6YUV3|PELO_THEON Protein pelota homolog OS=Thermococcus onnurineus (strain NA1) GN=pelA PE=3 SV=1 11 374 4.0E-34
sp|A5UKW7|PELO_METS3 Protein pelota homolog OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=pelA PE=3 SV=1 1 376 6.0E-34
sp|P80508|PE2R_RABIT Prostaglandin-E(2) 9-reductase OS=Oryctolagus cuniculus GN=AKR1C5 PE=1 SV=1 432 696 1.0E-33
sp|A1CRI1|XYL1_ASPCL Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xyl1 PE=3 SV=1 429 695 1.0E-33
sp|P28475|S6PD_MALDO NADP-dependent D-sorbitol-6-phosphate dehydrogenase OS=Malus domestica GN=S6PDH PE=2 SV=1 430 694 2.0E-33
sp|Q5REQ0|AK1C1_PONAB Aldo-keto reductase family 1 member C1 homolog OS=Pongo abelii GN=AKR1C1 PE=2 SV=1 431 694 2.0E-33
sp|P52898|DDBX_BOVIN Dihydrodiol dehydrogenase 3 OS=Bos taurus PE=2 SV=1 432 694 2.0E-33
sp|O27679|PELO_METTH Protein pelota homolog OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pelA PE=3 SV=2 12 376 2.0E-33
sp|Q54NZ7|ALRB_DICDI Aldose reductase B OS=Dictyostelium discoideum GN=alrB PE=3 SV=2 430 696 2.0E-33
sp|C9JRZ8|AK1BF_HUMAN Aldo-keto reductase family 1 member B15 OS=Homo sapiens GN=AKR1B15 PE=1 SV=2 428 686 4.0E-33
sp|P14065|GCY1_YEAST Glycerol 2-dehydrogenase (NADP(+)) OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCY1 PE=1 SV=1 429 694 6.0E-33
sp|P15121|ALDR_HUMAN Aldose reductase OS=Homo sapiens GN=AKR1B1 PE=1 SV=3 428 696 6.0E-33
sp|Q04828|AK1C1_HUMAN Aldo-keto reductase family 1 member C1 OS=Homo sapiens GN=AKR1C1 PE=1 SV=1 431 694 6.0E-33
sp|C5A5T8|PELO_THEGJ Protein pelota homolog OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pelA PE=3 SV=1 17 374 7.0E-33
sp|Q0CUL0|XYL1_ASPTN Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xyl1 PE=3 SV=1 429 695 7.0E-33
sp|Q5JIB9|PELO_THEKO Protein pelota homolog OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pelA PE=1 SV=1 13 374 7.0E-33
sp|P16116|ALDR_BOVIN Aldose reductase OS=Bos taurus GN=AKR1B1 PE=1 SV=1 429 696 2.0E-32
sp|P80276|ALDR_PIG Aldose reductase OS=Sus scrofa GN=AKR1B1 PE=1 SV=2 428 696 2.0E-32
sp|A0QL30|Y4483_MYCA1 Uncharacterized oxidoreductase MAV_4483 OS=Mycobacterium avium (strain 104) GN=MAV_4483 PE=3 SV=1 431 694 2.0E-32
sp|P52895|AK1C2_HUMAN Aldo-keto reductase family 1 member C2 OS=Homo sapiens GN=AKR1C2 PE=1 SV=3 431 694 2.0E-32
sp|P82125|AKCL2_PIG 1,5-anhydro-D-fructose reductase OS=Sus scrofa GN=AKR1E2 PE=1 SV=2 439 691 3.0E-32
sp|A1D4E3|XYL1_NEOFI Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xyl1 PE=3 SV=1 429 706 4.0E-32
sp|Q4WJT9|XYL1_ASPFU Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xyl1 PE=3 SV=1 429 695 4.0E-32
sp|B0XNR0|XYL1_ASPFC Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xyl1 PE=3 SV=1 429 695 4.0E-32
sp|Q568L5|A1A1B_DANRE Alcohol dehydrogenase [NADP(+)] B OS=Danio rerio GN=akr1a1b PE=2 SV=1 434 695 4.0E-32
sp|Q4DJ07|PGFS_TRYCC Prostaglandin F synthase OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511287.49 PE=1 SV=2 430 686 6.0E-32
sp|Q6W8P9|AK1CO_HORSE Aldo-keto reductase family 1 member C23-like protein OS=Equus caballus GN=PGFS PE=1 SV=1 433 694 8.0E-32
sp|P27800|ALDX_SPOSA Aldehyde reductase 1 OS=Sporidiobolus salmonicolor GN=ARI PE=1 SV=3 428 706 1.0E-31
sp|P07943|ALDR_RAT Aldose reductase OS=Rattus norvegicus GN=Akr1b1 PE=1 SV=3 428 696 2.0E-31
sp|Q0PGJ6|AKRC9_ARATH Aldo-keto reductase family 4 member C9 OS=Arabidopsis thaliana GN=AKR4C9 PE=1 SV=1 433 686 2.0E-31
sp|Q55FL3|ALRC_DICDI Aldose reductase C OS=Dictyostelium discoideum GN=alrC PE=3 SV=1 433 696 2.0E-31
sp|Q6Y0Z3|XYL1_CANPA NADH-dependent D-xylose reductase OS=Candida parapsilosis GN=XYL1 PE=1 SV=1 427 694 2.0E-31
sp|P45376|ALDR_MOUSE Aldose reductase OS=Mus musculus GN=Akr1b1 PE=1 SV=3 428 694 2.0E-31
sp|Q02198|MORA_PSEPU Morphine 6-dehydrogenase OS=Pseudomonas putida GN=morA PE=1 SV=3 429 698 2.0E-31
sp|Q73SC5|Y4149_MYCPA Uncharacterized oxidoreductase MAP_4149 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4149 PE=3 SV=1 431 694 3.0E-31
sp|O80944|AKRC8_ARATH Aldo-keto reductase family 4 member C8 OS=Arabidopsis thaliana GN=AKR4C8 PE=1 SV=2 434 686 3.0E-31
sp|G4MZI3|PRD1_MAGO7 NAD(P)H-dependent pentose reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRD1 PE=1 SV=1 430 695 3.0E-31
sp|Q9P8R5|XYL1_ASPNG NAD(P)H-dependent D-xylose reductase xyl1 OS=Aspergillus niger GN=xyl1 PE=2 SV=1 429 695 5.0E-31
sp|A2Q8B5|XYL1_ASPNC Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xyl1 PE=3 SV=1 429 695 5.0E-31
sp|P17516|AK1C4_HUMAN Aldo-keto reductase family 1 member C4 OS=Homo sapiens GN=AKR1C4 PE=1 SV=3 432 694 6.0E-31
sp|Q8TZ98|PELO_METKA Protein pelota homolog OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pelA PE=3 SV=1 1 376 6.0E-31
sp|P23457|DIDH_RAT 3-alpha-hydroxysteroid dehydrogenase OS=Rattus norvegicus GN=Akr1c9 PE=1 SV=1 427 694 6.0E-31
sp|Q0GYU4|GLD2_HYPJE Glycerol 2-dehydrogenase (NADP(+)) OS=Hypocrea jecorina GN=gld2 PE=1 SV=1 429 694 7.0E-31
sp|P15339|DKGB_CORSS 2,5-diketo-D-gluconic acid reductase B OS=Corynebacterium sp. (strain SHS752001) GN=dkgB PE=1 SV=3 431 695 2.0E-30
sp|Q91WR5|AK1CL_MOUSE Aldo-keto reductase family 1 member C21 OS=Mus musculus GN=Akr1c21 PE=1 SV=2 431 694 3.0E-30
sp|Q1XAA8|AK1CN_HORSE Aldo-keto reductase family 1 member C23 OS=Equus caballus GN=AKR1C23 PE=1 SV=1 432 694 3.0E-30
sp|P15122|ALDR_RABIT Aldose reductase OS=Oryctolagus cuniculus GN=AKR1B1 PE=2 SV=3 428 696 4.0E-30
sp|P51857|AK1D1_HUMAN 3-oxo-5-beta-steroid 4-dehydrogenase OS=Homo sapiens GN=AKR1D1 PE=1 SV=1 429 697 4.0E-30
sp|Q09632|YOF5_CAEEL Uncharacterized oxidoreductase ZK1290.5 OS=Caenorhabditis elegans GN=ZK1290.5 PE=3 SV=3 431 696 4.0E-30
sp|Q95JH5|AK1C4_MACFA Aldo-keto reductase family 1 member C4 OS=Macaca fascicularis GN=AKR1C4 PE=1 SV=1 432 694 5.0E-30
sp|P45377|ALD2_MOUSE Aldose reductase-related protein 2 OS=Mus musculus GN=Akr1b8 PE=1 SV=2 428 686 6.0E-30
sp|Q95JH4|AK1C4_MACFU Aldo-keto reductase family 1 member C4 OS=Macaca fuscata fuscata GN=AKR1C4 PE=1 SV=1 432 694 9.0E-30
sp|P51652|AKC1H_RAT Aldo-keto reductase family 1 member C18 OS=Rattus norvegicus GN=Akr1c18 PE=1 SV=1 432 694 1.0E-29
sp|P02532|CRO_RANTE Rho crystallin OS=Rana temporaria PE=2 SV=3 426 696 1.0E-29
sp|Q8ZH36|DKGB_YERPE 2,5-diketo-D-gluconic acid reductase B OS=Yersinia pestis GN=dkgB PE=3 SV=1 440 696 2.0E-29
sp|Q9TV64|AK1D1_RABIT 3-oxo-5-beta-steroid 4-dehydrogenase OS=Oryctolagus cuniculus GN=AKR1D1 PE=2 SV=1 426 697 3.0E-29
sp|Q3ZFI7|GAR1_HYPJE D-galacturonate reductase OS=Hypocrea jecorina GN=gar1 PE=1 SV=1 428 687 5.0E-29
sp|P21300|ALD1_MOUSE Aldose reductase-related protein 1 OS=Mus musculus GN=Akr1b7 PE=1 SV=4 428 696 7.0E-29
sp|P17264|CRO_LITCT Rho crystallin OS=Lithobates catesbeiana PE=1 SV=2 426 696 8.0E-29
sp|Q8VCX1|AK1D1_MOUSE 3-oxo-5-beta-steroid 4-dehydrogenase OS=Mus musculus GN=Akr1d1 PE=1 SV=1 432 697 9.0E-29
sp|Q96JD6|AKCL2_HUMAN 1,5-anhydro-D-fructose reductase OS=Homo sapiens GN=AKR1E2 PE=1 SV=2 439 696 1.0E-28
sp|Q8VC28|AK1CD_MOUSE Aldo-keto reductase family 1 member C13 OS=Mus musculus GN=Akr1c13 PE=1 SV=2 431 694 1.0E-28
sp|Q0GYU5|GLD1_HYPJE D/L-glyceraldehyde reductase OS=Hypocrea jecorina GN=gld1 PE=1 SV=1 431 678 1.0E-28
sp|O08782|ALD2_CRIGR Aldose reductase-related protein 2 OS=Cricetulus griseus GN=AKR1B8 PE=1 SV=3 428 686 2.0E-28
sp|C5FFQ7|XYL1_ARTOC Probable NAD(P)H-dependent D-xylose reductase xyl1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xyl1 PE=3 SV=1 424 695 2.0E-28
sp|Q84TF0|AKRCA_ARATH Aldo-keto reductase family 4 member C10 OS=Arabidopsis thaliana GN=AKR4C10 PE=1 SV=1 434 686 2.0E-28
sp|Q01213|DTDH_MUCMU 4-dihydromethyl-trisporate dehydrogenase OS=Mucor mucedo GN=tdh PE=1 SV=1 426 694 2.0E-28
sp|P31210|AK1D1_RAT 3-oxo-5-beta-steroid 4-dehydrogenase OS=Rattus norvegicus GN=Akr1d1 PE=1 SV=1 427 697 2.0E-28
sp|Q57638|PELO_METJA Protein pelota homolog OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pelA PE=3 SV=1 17 376 3.0E-28
sp|Q6GMC7|AK1A1_XENLA Alcohol dehydrogenase [NADP(+)] OS=Xenopus laevis GN=akr1a1 PE=2 SV=1 434 694 4.0E-28
sp|Q5ZK84|AK1A1_CHICK Alcohol dehydrogenase [NADP(+)] OS=Gallus gallus GN=AKR1A1 PE=2 SV=1 432 686 8.0E-28
sp|Q28FD1|AK1A1_XENTR Alcohol dehydrogenase [NADP(+)] OS=Xenopus tropicalis GN=akr1a1 PE=2 SV=1 434 694 1.0E-27
sp|Q8K023|AKC1H_MOUSE Aldo-keto reductase family 1 member C18 OS=Mus musculus GN=Akr1c18 PE=1 SV=2 432 694 1.0E-27
sp|P49378|XYL1_KLULA NAD(P)H-dependent D-xylose reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=XYL1 PE=3 SV=1 428 698 2.0E-27
sp|Q876L8|XYL1_HYPJE NAD(P)H-dependent D-xylose reductase xyl1 OS=Hypocrea jecorina GN=xyl1 PE=1 SV=1 429 691 3.0E-27
sp|H9JTG9|AK2E4_BOMMO Aldo-keto reductase AKR2E4 OS=Bombyx mori GN=akr2e PE=1 SV=1 429 695 9.0E-27
sp|Q9V0V3|PELO_PYRAB Protein pelota homolog OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pelA PE=3 SV=1 13 376 1.0E-26
sp|P23901|ALDR_HORVU Aldose reductase OS=Hordeum vulgare PE=1 SV=1 434 696 1.0E-26
sp|Q8X195|XYL1_CANBO NADPH-dependent D-xylose reductase OS=Candida boidinii GN=XYL1 PE=1 SV=2 429 694 1.0E-26
sp|Q5U1Y4|AKCL2_RAT 1,5-anhydro-D-fructose reductase OS=Rattus norvegicus GN=Akr1e2 PE=2 SV=1 438 696 2.0E-26
sp|Q9DCT1|AKCL2_MOUSE 1,5-anhydro-D-fructose reductase OS=Mus musculus GN=Akr1e2 PE=1 SV=1 440 709 2.0E-26
sp|O59148|PELO_PYRHO Protein pelota homolog OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pelA PE=3 SV=1 13 376 2.0E-26
sp|B1L659|PELO_KORCO Protein pelota homolog OS=Korarchaeum cryptofilum (strain OPF8) GN=pelA PE=3 SV=1 11 374 2.0E-26
sp|Q9M338|AKRCB_ARATH Aldo-keto reductase family 4 member C11 OS=Arabidopsis thaliana GN=AKR4C11 PE=1 SV=1 433 688 3.0E-26
sp|Q5RJP0|ALD1_RAT Aldose reductase-related protein 1 OS=Rattus norvegicus GN=Akr1b7 PE=1 SV=1 428 696 3.0E-26
sp|Q4R802|AKCL2_MACFA 1,5-anhydro-D-fructose reductase OS=Macaca fascicularis GN=AKR1E2 PE=2 SV=1 439 696 3.0E-26
sp|Q76L37|CPRC1_CANPA NADPH-dependent conjugated polyketone reductase C1 OS=Candida parapsilosis GN=cpr-c1 PE=1 SV=1 433 695 7.0E-26
sp|Q2NFD9|PELO_METST Protein pelota homolog OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pelA PE=3 SV=1 11 376 8.0E-26
sp|O49133|GALUR_FRAAN D-galacturonate reductase OS=Fragaria ananassa GN=GALUR PE=1 SV=1 424 695 2.0E-25
sp|A4G0A4|PELO_METM5 Protein pelota homolog OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pelA PE=3 SV=1 13 376 3.0E-25
sp|Q6AYQ2|AK1CL_RAT Aldo-keto reductase family 1 member C21 OS=Rattus norvegicus GN=Akr1c21 PE=2 SV=1 431 681 5.0E-25
sp|P82809|AK1CD_MESAU Aldo-keto reductase family 1 member C13 OS=Mesocricetus auratus GN=AKR1C13 PE=1 SV=1 437 694 7.0E-25
sp|Q0W6H4|PELO_METAR Protein pelota homolog OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pelA PE=3 SV=1 16 376 7.0E-25
sp|Q8ZRM7|DKGB_SALTY 2,5-diketo-D-gluconic acid reductase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dkgB PE=3 SV=1 440 694 1.0E-24
sp|Q8Z988|DKGB_SALTI 2,5-diketo-D-gluconic acid reductase B OS=Salmonella typhi GN=dkgB PE=3 SV=1 440 694 1.0E-24
sp|A6VI74|PELO_METM7 Protein pelota homolog OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pelA PE=3 SV=1 13 376 2.0E-24
sp|P38715|GRE3_YEAST NADPH-dependent aldose reductase GRE3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE3 PE=1 SV=1 428 688 2.0E-24
sp|A9A8K6|PELO_METM6 Protein pelota homolog OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pelA PE=3 SV=1 13 376 2.0E-24
sp|P30863|DKGB_ECOLI 2,5-diketo-D-gluconic acid reductase B OS=Escherichia coli (strain K12) GN=dkgB PE=1 SV=2 440 694 2.0E-24
sp|Q8X7Z7|DKGB_ECO57 2,5-diketo-D-gluconic acid reductase B OS=Escherichia coli O157:H7 GN=dkgB PE=3 SV=1 440 694 3.0E-24
sp|B8GIR5|PELO_METPE Protein pelota homolog OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pelA PE=3 SV=1 8 376 3.0E-24
sp|Q8U150|PELO_PYRFU Protein pelota homolog OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pelA PE=3 SV=1 13 376 6.0E-24
sp|A6UR75|PELO_METVS Protein pelota homolog OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pelA PE=3 SV=1 13 376 9.0E-24
sp|G4N708|XYL1_MAGO7 NAD(P)H-dependent D-xylose reductase XYR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYR1 PE=2 SV=1 429 695 1.0E-23
sp|P78736|XYL1_PACTA NAD(P)H-dependent D-xylose reductase OS=Pachysolen tannophilus GN=XYL1 PE=1 SV=1 434 708 1.0E-23
sp|Q9SQ64|COR2_PAPSO Non-functional NADPH-dependent codeinone reductase 2 OS=Papaver somniferum GN=COR2 PE=1 SV=1 431 695 1.0E-23
sp|A7I7Y6|PELO_METB6 Protein pelota homolog OS=Methanoregula boonei (strain 6A8) GN=pelA PE=3 SV=1 16 376 2.0E-23
sp|Q6M133|PELO_METMP Protein pelota homolog OS=Methanococcus maripaludis (strain S2 / LL) GN=pelA PE=3 SV=1 13 376 2.0E-23
sp|Q9SQ69|COR12_PAPSO NADPH-dependent codeinone reductase 1-2 OS=Papaver somniferum GN=COR1.2 PE=1 SV=1 424 695 3.0E-23
sp|Q9SQ67|COR14_PAPSO NADPH-dependent codeinone reductase 1-4 OS=Papaver somniferum GN=COR1.4 PE=1 SV=2 424 695 4.0E-23
sp|Q7G764|NADO1_ORYSJ Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1 440 686 6.0E-23
sp|P26690|6DCS_SOYBN NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1 422 690 6.0E-23
sp|O42888|YBN4_SCHPO Uncharacterized oxidoreductase C8E4.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.04 PE=3 SV=1 434 687 7.0E-23
sp|Q12W71|PELO_METBU Protein pelota homolog OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pelA PE=3 SV=1 4 376 7.0E-23
sp|A6UUY1|PELO_META3 Protein pelota homolog OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pelA PE=3 SV=1 13 376 7.0E-23
sp|A3CU20|PELO_METMJ Protein pelota homolog OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pelA PE=3 SV=1 16 376 8.0E-23
sp|B9LQI7|PELO_HALLT Protein pelota homolog OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=pelA PE=3 SV=1 15 376 1.0E-22
sp|Q7G765|NADO2_ORYSJ Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1 440 686 4.0E-22
sp|A0B6U3|PELO_METTP Protein pelota homolog OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pelA PE=3 SV=2 1 376 5.0E-22
sp|Q8PVZ0|PELO_METMA Protein pelota homolog OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pelA PE=3 SV=1 14 376 8.0E-22
sp|O13848|I3ACR_SCHPO NAD/NADP-dependent indole-3-acetaldehyde reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.09 PE=1 SV=1 437 696 1.0E-21
sp|Q10494|YDG7_SCHPO Uncharacterized oxidoreductase C26F1.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.07 PE=3 SV=1 434 678 2.0E-21
sp|Q46C69|PELO_METBF Protein pelota homolog OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pelA PE=3 SV=1 14 376 3.0E-21
sp|Q07551|KAR_YEAST NADPH-dependent alpha-keto amide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL124W PE=1 SV=1 434 695 4.0E-21
sp|O29421|PELO_ARCFU Protein pelota homolog OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pelA PE=1 SV=1 14 374 4.0E-21
sp|Q18J81|PELO_HALWD Protein pelota homolog OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pelA PE=3 SV=1 14 376 9.0E-21
sp|Q8TSZ1|PELO_METAC Protein pelota homolog OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pelA PE=3 SV=1 14 376 1.0E-20
sp|Q2FQH4|PELO_METHJ Protein pelota homolog OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pelA PE=3 SV=1 8 376 1.0E-20
sp|Q8SSK6|ALDR_ENCCU Aldose reductase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0970 PE=1 SV=1 428 694 2.0E-20
sp|A3DMX7|PELO_STAMF Protein pelota homolog OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pelA PE=3 SV=1 11 376 2.0E-20
sp|E7C196|MER_ERYCB Methylecgonone reductase OS=Erythroxylum coca PE=1 SV=1 432 690 5.0E-20
sp|A2SQV7|PELO_METLZ Protein pelota homolog OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pelA PE=3 SV=1 16 376 5.0E-20
sp|Q5V3G6|PELO_HALMA Protein pelota homolog OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pelA PE=3 SV=1 15 376 1.0E-19
sp|Q3INN9|PELO_NATPD Protein pelota homolog OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pelA PE=3 SV=1 1 376 2.0E-19
sp|Q9HPR5|PELO_HALSA Protein pelota homolog OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pelA PE=3 SV=1 15 376 3.0E-19
sp|B0R5R9|PELO_HALS3 Protein pelota homolog OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pelA PE=3 SV=1 15 376 3.0E-19
sp|P74308|AKR_SYNY3 Aldo/keto reductase slr0942 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0942 PE=1 SV=1 434 691 5.0E-19
sp|O70473|AK1A1_CRIGR Alcohol dehydrogenase [NADP(+)] (Fragment) OS=Cricetulus griseus GN=AKR1A1 PE=2 SV=1 442 633 1.0E-18
sp|B9VRJ2|COR15_PAPSO NADPH-dependent codeinone reductase 1-5 OS=Papaver somniferum GN=COR1.5 PE=1 SV=1 432 695 2.0E-18
sp|Q9SQ70|COR11_PAPSO NADPH-dependent codeinone reductase 1-1 OS=Papaver somniferum GN=COR1.1 PE=1 SV=1 432 695 7.0E-18
sp|P0DKI7|STORR_PAPSO Bifunctional protein STORR OS=Papaver somniferum GN=STORR PE=1 SV=1 432 694 3.0E-17
sp|A8A935|PELO_IGNH4 Protein pelota homolog OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pelA PE=3 SV=1 6 376 1.0E-16
sp|Q9SQ68|COR13_PAPSO NADPH-dependent codeinone reductase 1-3 OS=Papaver somniferum GN=COR1.3 PE=1 SV=1 424 695 3.0E-16
sp|Q5T2L2|AKCL1_HUMAN Putative aldo-keto reductase family 1 member C8 OS=Homo sapiens GN=AKR1C8P PE=5 SV=2 422 540 2.0E-15
sp|P38115|ARA1_YEAST D-arabinose dehydrogenase [NAD(P)+] heavy chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARA1 PE=1 SV=1 434 688 9.0E-15
sp|Q9HJ74|PELO_THEAC Protein pelota homolog OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pelA PE=1 SV=1 11 374 1.0E-14
sp|Q9YAZ5|PELO_AERPE Protein pelota homolog OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pelA PE=1 SV=2 6 376 2.0E-14
sp|A2BL82|PELO_HYPBU Protein pelota homolog OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pelA PE=3 SV=1 1 131 3.0E-12
sp|B8D691|PELO_DESK1 Protein pelota homolog OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=pelA PE=3 SV=1 11 377 3.0E-12
sp|A1RXN2|PELO_THEPD Protein pelota homolog OS=Thermofilum pendens (strain Hrk 5) GN=pelA PE=3 SV=2 26 376 4.0E-11
sp|A4YIP3|PELO_METS5 Protein pelota homolog OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=pelA PE=3 SV=1 22 374 2.0E-10
sp|P76234|YEAE_ECOLI Uncharacterized protein YeaE OS=Escherichia coli (strain K12) GN=yeaE PE=4 SV=1 432 699 9.0E-10
sp|Q6L2M8|PELO_PICTO Protein pelota homolog OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pelA PE=3 SV=1 7 376 2.0E-09
sp|C3MYZ5|PELO_SULIM Protein pelota homolog OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pelA PE=3 SV=1 22 374 1.0E-08
sp|C4KJ83|PELO_SULIK Protein pelota homolog OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pelA PE=3 SV=1 22 374 1.0E-08
sp|C3N044|PELO_SULIA Protein pelota homolog OS=Sulfolobus islandicus (strain M.16.27) GN=pelA PE=3 SV=1 6 323 2.0E-08
sp|Q97BJ3|PELO_THEVO Protein pelota homolog OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pelA PE=3 SV=1 9 376 2.0E-07
sp|B1Y9M9|PELO_PYRNV Protein pelota homolog OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pelA PE=3 SV=1 7 374 2.0E-07
sp|Q96YU9|PELO_SULTO Protein pelota homolog OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pelA PE=3 SV=1 22 374 2.0E-07
sp|A0RWD1|PELO_CENSY Protein pelota homolog OS=Cenarchaeum symbiosum (strain A) GN=pelA PE=3 SV=1 12 116 7.0E-07
sp|P96026|PELO_SULSO Protein pelota homolog OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pelA PE=1 SV=1 6 374 1.0E-06
sp|A1RRT7|PELO_PYRIL Protein pelota homolog OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pelA PE=3 SV=1 10 116 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5411
MKLVARKMLVDVEEEQVSLLPEDPEDMWHAYNLIVAGDLVNAHAIRKVVTVNSGTGAAAAERVHTDLTIRVKSTF
FDPVVSSLRVSGVVFAENDHVSRGSHHTLDLEVNRSFAIVKPDGWNSVFKTTLAQALSDDRNGALAAVVMQDGLA
NICLITQFRTVIKTRVESVVPKKRDTASDQDAGMRRFYDKTLQSLLRALDFSNTRPLLLASPGFIAADFKEYIAR
QGRDKSDKVLTAMAKQATVIHANSGHVHSLNEVLKSPQVLAKMRNMNYAKEAQYMDSFFDLLKLDDGRAWYGTKA
VDKAVADGAVGPGGGVLLINNALFRSEVLDTRKRYVALVDKVKEFGGEVRILSSDHESGQRLKMMGDIAAILNYP
MLDLDEEDEEEEAVLEDRDDGTRHELDESILGNFPHPPIVPANKKKMAPRLTLSSTVRLNSGYEMPVLGFGVYQI
PKEEATKACEEALKVGYRHIDSASGYRNQGPCAKAIQTSGLARSDIFFTTKIPTREHPLNYENTHTLIDKALSET
QLSYLDLVLIHSPYGGSANRKAAWRALVESVQAGKVRSIGVSNYGAAHLAELEVHRAELEAEEPGLGGVVSVGQW
EVHPWLTRGDVVGWCRERGVAVQAYCAVVRGERFGHEAVKSVAERLGKTEAQILLRWSLQMGFVPLVKSVTPSRM
VENAALFDFELEKGDVEAMTTDEYSPCAWDPTIEPLEK*
Coding >Ophun1|5411
ATGAAGCTGGTCGCGAGAAAGATGCTGGTGGACGTCGAGGAGGAGCAGGTGTCTCTTCTACCCGAAGACCCCGAG
GACATGTGGCACGCCTACAACCTCATCGTCGCCGGCGATCTCGTCAACGCGCACGCCATCCGCAAGGTCGTCACC
GTTAACTCCGGAACTGGCGCCGCGGCAGCCGAGCGTGTTCATACCGATCTGACGATCCGCGTCAAGTCGACCTTT
TTCGATCCCGTCGTCTCCTCGCTTCGCGTCTCGGGCGTCGTCTTTGCCGAAAACGACCACGTCTCTCGCGGCTCG
CATCATACGCTAGATCTCGAAGTCAACCGATCGTTTGCCATTGTCAAGCCCGATGGCTGGAACTCGGTCTTTAAG
ACGACGCTGGCTCAGGCCCTCTCGGATGACAGGAACGGGGCTCTGGCCGCCGTCGTGATGCAAGACGGCCTCGCC
AACATCTGTCTCATCACTCAGTTCCGCACCGTCATCAAGACTCGCGTCGAGAGCGTGGTGCCGAAGAAGCGCGAT
ACCGCCTCGGATCAGGACGCCGGCATGAGGCGCTTCTACGACAAGACGCTCCAATCGCTACTCCGCGCTCTCGAC
TTCTCCAATACACGGCCCCTGCTACTAGCCAGCCCCGGCTTCATCGCCGCCGACTTTAAAGAGTACATTGCCAGA
CAAGGCCGCGACAAGTCGGACAAGGTGCTCACTGCCATGGCCAAACAAGCGACAGTGATCCACGCCAACTCGGGC
CACGTGCACAGCCTAAACGAGGTGCTCAAGAGTCCGCAGGTGTTGGCCAAGATGCGCAACATGAATTACGCCAAA
GAAGCGCAGTACATGGACAGCTTCTTCGATCTTCTCAAGCTGGACGATGGGCGAGCCTGGTACGGCACCAAGGCG
GTGGACAAGGCGGTAGCGGACGGTGCCGTCGGTCCGGGCGGAGGCGTGCTGCTGATCAACAACGCTCTTTTCCGA
AGCGAGGTGTTGGACACGCGCAAGAGATATGTTGCTCTCGTCGACAAGGTCAAGGAGTTTGGGGGGGAGGTGAGG
ATACTGAGCAGCGATCATGAAAGCGGACAGCGGTTGAAGATGATGGGAGACATTGCGGCCATACTGAATTACCCG
ATGCTCGACCTGGATGAGGAAGATGAAGAGGAGGAGGCGGTACTTGAGGATCGGGACGATGGGACGAGACACGAA
TTAGATGAGAGCATCCTCGGCAACTTCCCGCACCCTCCGATTGTCCCAGCAAACAAGAAGAAGATGGCGCCGCGA
CTGACCCTCAGCTCGACCGTCAGGCTCAACTCGGGATACGAGATGCCCGTCCTTGGCTTCGGGGTCTATCAGATA
CCCAAGGAGGAGGCCACCAAAGCGTGCGAAGAAGCTCTGAAAGTCGGGTACCGGCATATCGACTCGGCATCAGGA
TATCGCAACCAAGGCCCCTGCGCCAAAGCGATCCAAACCTCAGGCCTCGCCCGCAGCGACATCTTCTTCACCACC
AAGATCCCCACCCGCGAACACCCGCTCAACTACGAAAACACGCACACGCTCATCGACAAAGCCCTGTCGGAAACC
CAGCTCTCCTACCTGGACCTCGTCCTCATCCACAGCCCCTACGGCGGCAGCGCCAACCGCAAAGCCGCCTGGCGC
GCCCTCGTAGAGAGCGTCCAGGCCGGAAAAGTCCGCTCCATCGGCGTCTCCAACTACGGCGCCGCCCACCTGGCC
GAGCTCGAGGTCCACCGCGCCGAGCTGGAAGCCGAGGAGCCGGGGCTGGGCGGCGTGGTGTCCGTCGGGCAGTGG
GAGGTGCATCCCTGGCTGACGAGGGGCGATGTCGTGGGGTGGTGTCGGGAGAGGGGCGTCGCGGTGCAGGCGTAT
TGCGCAGTTGTGCGTGGGGAGCGCTTCGGTCACGAGGCTGTCAAGTCTGTGGCGGAGAGGCTGGGGAAGACGGAG
GCGCAGATACTGCTCAGGTGGAGCTTGCAGATGGGGTTCGTGCCGTTGGTGAAGAGCGTGACGCCGTCGCGGATG
GTGGAGAATGCGGCGCTGTTCGACTTTGAGCTTGAGAAGGGGGATGTTGAGGCCATGACGACGGATGAGTATAGT
CCCTGCGCGTGGGATCCCACCATTGAGCCGTTGGAGAAGTAG
Transcript >Ophun1|5411
ATGAAGCTGGTCGCGAGAAAGATGCTGGTGGACGTCGAGGAGGAGCAGGTGTCTCTTCTACCCGAAGACCCCGAG
GACATGTGGCACGCCTACAACCTCATCGTCGCCGGCGATCTCGTCAACGCGCACGCCATCCGCAAGGTCGTCACC
GTTAACTCCGGAACTGGCGCCGCGGCAGCCGAGCGTGTTCATACCGATCTGACGATCCGCGTCAAGTCGACCTTT
TTCGATCCCGTCGTCTCCTCGCTTCGCGTCTCGGGCGTCGTCTTTGCCGAAAACGACCACGTCTCTCGCGGCTCG
CATCATACGCTAGATCTCGAAGTCAACCGATCGTTTGCCATTGTCAAGCCCGATGGCTGGAACTCGGTCTTTAAG
ACGACGCTGGCTCAGGCCCTCTCGGATGACAGGAACGGGGCTCTGGCCGCCGTCGTGATGCAAGACGGCCTCGCC
AACATCTGTCTCATCACTCAGTTCCGCACCGTCATCAAGACTCGCGTCGAGAGCGTGGTGCCGAAGAAGCGCGAT
ACCGCCTCGGATCAGGACGCCGGCATGAGGCGCTTCTACGACAAGACGCTCCAATCGCTACTCCGCGCTCTCGAC
TTCTCCAATACACGGCCCCTGCTACTAGCCAGCCCCGGCTTCATCGCCGCCGACTTTAAAGAGTACATTGCCAGA
CAAGGCCGCGACAAGTCGGACAAGGTGCTCACTGCCATGGCCAAACAAGCGACAGTGATCCACGCCAACTCGGGC
CACGTGCACAGCCTAAACGAGGTGCTCAAGAGTCCGCAGGTGTTGGCCAAGATGCGCAACATGAATTACGCCAAA
GAAGCGCAGTACATGGACAGCTTCTTCGATCTTCTCAAGCTGGACGATGGGCGAGCCTGGTACGGCACCAAGGCG
GTGGACAAGGCGGTAGCGGACGGTGCCGTCGGTCCGGGCGGAGGCGTGCTGCTGATCAACAACGCTCTTTTCCGA
AGCGAGGTGTTGGACACGCGCAAGAGATATGTTGCTCTCGTCGACAAGGTCAAGGAGTTTGGGGGGGAGGTGAGG
ATACTGAGCAGCGATCATGAAAGCGGACAGCGGTTGAAGATGATGGGAGACATTGCGGCCATACTGAATTACCCG
ATGCTCGACCTGGATGAGGAAGATGAAGAGGAGGAGGCGGTACTTGAGGATCGGGACGATGGGACGAGACACGAA
TTAGATGAGAGCATCCTCGGCAACTTCCCGCACCCTCCGATTGTCCCAGCAAACAAGAAGAAGATGGCGCCGCGA
CTGACCCTCAGCTCGACCGTCAGGCTCAACTCGGGATACGAGATGCCCGTCCTTGGCTTCGGGGTCTATCAGATA
CCCAAGGAGGAGGCCACCAAAGCGTGCGAAGAAGCTCTGAAAGTCGGGTACCGGCATATCGACTCGGCATCAGGA
TATCGCAACCAAGGCCCCTGCGCCAAAGCGATCCAAACCTCAGGCCTCGCCCGCAGCGACATCTTCTTCACCACC
AAGATCCCCACCCGCGAACACCCGCTCAACTACGAAAACACGCACACGCTCATCGACAAAGCCCTGTCGGAAACC
CAGCTCTCCTACCTGGACCTCGTCCTCATCCACAGCCCCTACGGCGGCAGCGCCAACCGCAAAGCCGCCTGGCGC
GCCCTCGTAGAGAGCGTCCAGGCCGGAAAAGTCCGCTCCATCGGCGTCTCCAACTACGGCGCCGCCCACCTGGCC
GAGCTCGAGGTCCACCGCGCCGAGCTGGAAGCCGAGGAGCCGGGGCTGGGCGGCGTGGTGTCCGTCGGGCAGTGG
GAGGTGCATCCCTGGCTGACGAGGGGCGATGTCGTGGGGTGGTGTCGGGAGAGGGGCGTCGCGGTGCAGGCGTAT
TGCGCAGTTGTGCGTGGGGAGCGCTTCGGTCACGAGGCTGTCAAGTCTGTGGCGGAGAGGCTGGGGAAGACGGAG
GCGCAGATACTGCTCAGGTGGAGCTTGCAGATGGGGTTCGTGCCGTTGGTGAAGAGCGTGACGCCGTCGCGGATG
GTGGAGAATGCGGCGCTGTTCGACTTTGAGCTTGAGAAGGGGGATGTTGAGGCCATGACGACGGATGAGTATAGT
CCCTGCGCGTGGGATCCCACCATTGAGCCGTTGGAGAAGTAG
Gene >Ophun1|5411
ATGAAGCTGGTCGCGAGAAAGATGCTGGTGGACGTCGAGGAGGAGCAGGTGTCTCTTCTACCCGAAGACCCCGAG
GACATGGTTCGTCTGCAGCCTCATCAACAGTGTGCTGCCCAAACTGACGCGTCGCGACGCAGTGGCACGCCTACA
ACCTCATCGTCGCCGGCGATCTCGTCAACGCGCACGCCATCCGCAAGGTCGTCACCGTTAACTCCGGAACTGGCG
CCGCGGCAGCCGAGCGTGTTCATACCGATCTGACGATCCGCGTCAAGTCGACCTTTTTCGATCCCGTCGTCTCCT
CGCTTCGCGTCTCGGGCGTCGTCTTTGCCGAAAACGACCACGTCTCTCGCGGCTCGCATCATACGCTAGATCTCG
AAGTCAACCGATCGTTTGCCATTGTCAAGCCCGATGGCTGGAACTCGGTCTTTAAGACGACGCTGGCTCAGGCCC
TCTCGGATGACAGGAACGGGGCTCTGGCCGCCGTCGTGATGCAAGACGGCCTCGCCAACATCTGTCTCATCACTC
AGTTCCGCACCGTCATCAAGACTCGCGTCGAGAGCGTGGTGCCGAAGAAGCGCGATACCGCCTCGGATCAGGACG
CCGGCATGAGGCGCTTCTACGACAAGACGCTCCAATCGCTACTCCGCGCTCTCGACTTCTCCAATACACGGCCCC
TGCTACTAGCCAGCCCCGGCTTCATCGCCGCCGACTTTAAAGAGTACATTGCCAGACAAGGCCGCGACAAGTCGG
ACAAGGTGCTCACTGCCATGGCCAAACAAGCGACAGTGATCCACGCCAACTCGGGCCACGTGCACAGCCTAAACG
AGGTGCTCAAGAGTCCGCAGGTGTTGGCCAAGATGCGCAACATGAATTACGCCAAAGAAGCGCAGTACATGGACA
GCTTCTTCGATCTTCTCAAGCTGGACGATGGGCGAGCCTGGTACGGCACCAAGGCGGTGGACAAGGCGGTAGCGG
ACGGTGCCGTCGGTCCGGGCGGAGGCGTGCTGCTGATCAACAACGCTCTTTTCCGAAGCGAGGTGTTGGACACGC
GCAAGAGATATGTTGCTCTCGTCGACAAGGTCAAGGAGTTTGGGGGGGAGGTGAGGATACTGAGCAGCGATCATG
AAAGCGGACAGCGGTTGAAGATGATGGGAGACATTGCGGCCATACTGAATTACCCGATGCTCGACCTGGATGAGG
AAGATGAAGAGGAGGAGGCGGTACTTGAGGATCGGGACGATGGGACGAGACACGAATTAGATGAGAGCATGTTAG
ATAGCGTTGTCTAGGGTCGCACATATTTACCAATGCGTACGAATACATACATCTTCATCTGTTGACGGCCATGAT
TCCGCGACTGAGGCGTTGAATGACGTAGACGAGATGTTGATGTACGAGTAAGAGGTGATGATGGTATCAGCACAT
CAACAAAGCCGAGGCAGACTAGAACAAGCCCAGTTGACAAACAGCCGCCCATGGAGCTTCCCCTACAGGCAGGTC
CTCAATGACTGATTTCCAATCATGACCCCTAGCTGGGGCCCTAGGAAGTGATGGCCAAATAGCCCCAGCTCCCCA
CAACAGCCGAAACCAAACCAGCCCCATGGCCCTCCAGCCTCGGCAACTTCCCGCACCCTCCGATTGTCCCAGCAA
ACAAGAAGAAGATGGCGCCGCGACTGACCCTCAGCTCGACCGTCAGGCTCAACTCGGGATACGAGATGCCCGTCC
TTGGCTTCGGGGTAGGTTTCTTCCCGTGGGGAGCTTTGAGACGGTTGTGTTGACTTGGTGGCAGGTCTATCAGAT
GTGAGGGTTTATCGTGGGCTTCGTGACGTTGACTGACGGGGAGAAGACCCAAGGAGGAGGCCACCAAAGCGTGCG
AAGAAGCTCTGAAAGTCGGGTACCGGCATGTACGGCAGCCCTCATCGCAGAGTCTCCCGGTGATATATATCCCCT
CGCTCACCGTCAGCAGATCGACTCGGCATCAGGATATCGCAACCAAGGCCCCTGCGCCAAAGCGATCCAAACCTC
AGGCCTCGCCCGCAGCGACATCTTCTTCACCACCAAGATCCCCACCCGCGAACACCCGCTCAACTACGAAAACAC
GCACACGCTCATCGACAAAGCCCTGTCGGAAACCCAGCTCTCCTACCTGGACCTCGTCCTCATCCACAGCCCCTA
CGGCGGCAGCGCCAACCGCAAAGCCGCCTGGCGCGCCCTCGTAGAGAGCGTCCAGGCCGGAAAAGTCCGCTCCAT
CGGCGTCTCCAACTACGGCGCCGCCCACCTGGCCGAGCTCGAGGTCCACCGCGCCGAGCTGGAAGCCGAGGAGCC
GGGGCTGGGCGGCGTGGTGTCCGTCGGGCAGTGGGAGGTGCATCCCTGGCTGACGAGGGGCGATGTCGTGGGGTG
GTGTCGGGAGAGGGGCGTCGCGGTGCAGGCGTATTGCGCAGTTGTGCGTGGGGAGCGCTTCGGTCACGAGGCTGT
CAAGTCTGTGGCGGAGAGGCTGGGGAAGACGGAGGCGCAGATACTGCTCAGGTGGAGCTTGCAGATGGGGTTCGT
GCCGTTGGTGAAGAGCGTGACGCCGTCGCGGATGGTGGAGAATGCGGCGCTGTTCGACTTTGAGCTTGAGAAGGG
GGATGTTGAGGCCATGACGACGGATGAGTATAGTCCCTGCGCGTGGGATCCCACCATTGAGCCGTTGGAGAAGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail