Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|541
Gene name
LocationContig_117:28..2272
Strand-
Gene length (bp)2244
Transcript length (bp)1872
Coding sequence length (bp)1872
Protein length (aa) 624

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.6E-09 6 69
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.2E-18 306 373
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 8.8E-10 488 550

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 2 610 0.0E+00
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 1 612 5.0E-145
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 1 610 2.0E-136
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 4 610 2.0E-115
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 4 610 6.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 2 610 0.0E+00
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 1 612 5.0E-145
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 1 610 2.0E-136
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 4 610 2.0E-115
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 4 610 6.0E-111
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 4 608 6.0E-109
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 4 610 9.0E-103
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 4 612 1.0E-100
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 4 612 2.0E-100
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 4 612 2.0E-97
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 297 612 1.0E-72
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 300 610 1.0E-59
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 300 610 1.0E-59
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 300 561 5.0E-55
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 300 609 1.0E-50
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 279 561 2.0E-49
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 4 163 2.0E-11
sp|Q8L3X8|SRC30_ARATH Serine/arginine-rich SC35-like splicing factor SCL30 OS=Arabidopsis thaliana GN=SCL30 PE=1 SV=1 306 384 2.0E-10
sp|Q1PDV2|SRC28_ARATH Serine/arginine-rich SC35-like splicing factor SCL28 OS=Arabidopsis thaliana GN=SCL28 PE=1 SV=1 301 385 3.0E-10
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 305 382 3.0E-09
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 303 390 6.0E-09
sp|Q9LHP2|SL30A_ARATH Serine/arginine-rich SC35-like splicing factor SCL30A OS=Arabidopsis thaliana GN=SCL30A PE=1 SV=1 306 377 6.0E-09
sp|Q9SEU4|SRC33_ARATH Serine/arginine-rich SC35-like splicing factor SCL33 OS=Arabidopsis thaliana GN=SCL33 PE=1 SV=1 306 377 8.0E-09
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 283 392 1.0E-08
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 306 386 1.0E-08
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 283 392 1.0E-08
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 303 368 3.0E-08
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 291 376 4.0E-08
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 4 128 4.0E-08
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 305 382 4.0E-08
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 291 376 5.0E-08
sp|Q8WP23|BOLL_MACFA Protein boule-like OS=Macaca fascicularis GN=BOLL PE=2 SV=2 304 387 1.0E-07
sp|Q8N9W6|BOLL_HUMAN Protein boule-like OS=Homo sapiens GN=BOLL PE=1 SV=2 304 387 1.0E-07
sp|Q924M5|BOLL_MOUSE Protein boule-like OS=Mus musculus GN=Boll PE=1 SV=2 304 387 1.0E-07
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 291 376 2.0E-07
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 291 376 2.0E-07
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 291 376 2.0E-07
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 291 376 2.0E-07
sp|A1A5R1|RFOX2_RAT RNA binding protein fox-1 homolog 2 OS=Rattus norvegicus GN=Rbfox2 PE=2 SV=1 285 382 2.0E-07
sp|Q8BP71|RFOX2_MOUSE RNA binding protein fox-1 homolog 2 OS=Mus musculus GN=Rbfox2 PE=1 SV=2 285 382 2.0E-07
sp|A6QPR6|RFOX2_BOVIN RNA binding protein fox-1 homolog 2 OS=Bos taurus GN=RBFOX2 PE=2 SV=2 285 382 2.0E-07
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 291 376 2.0E-07
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 308 401 2.0E-07
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 303 368 2.0E-07
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 301 378 2.0E-07
sp|Q5NVN8|RFOX1_PONAB RNA binding protein fox-1 homolog 1 OS=Pongo abelii GN=RBFOX1 PE=2 SV=1 215 382 3.0E-07
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 306 383 3.0E-07
sp|O43251|RFOX2_HUMAN RNA binding protein fox-1 homolog 2 OS=Homo sapiens GN=RBFOX2 PE=1 SV=3 285 382 3.0E-07
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 304 400 4.0E-07
sp|Q8BIF2|RFOX3_MOUSE RNA binding protein fox-1 homolog 3 OS=Mus musculus GN=Rbfox3 PE=1 SV=2 287 382 4.0E-07
sp|Q95KI0|RFOX1_MACFA RNA binding protein fox-1 homolog 1 OS=Macaca fascicularis GN=RBFOX1 PE=2 SV=1 215 382 4.0E-07
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 300 417 5.0E-07
sp|Q9NWB1|RFOX1_HUMAN RNA binding protein fox-1 homolog 1 OS=Homo sapiens GN=RBFOX1 PE=1 SV=2 215 382 5.0E-07
sp|Q9JJ43|RFOX1_MOUSE RNA binding protein fox-1 homolog 1 OS=Mus musculus GN=Rbfox1 PE=1 SV=3 281 382 5.0E-07
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 302 372 6.0E-07
sp|A6NFN3|RFOX3_HUMAN RNA binding protein fox-1 homolog 3 OS=Homo sapiens GN=RBFOX3 PE=2 SV=4 305 382 6.0E-07
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 300 388 8.0E-07
sp|Q54WM4|EIF3G_DICDI Eukaryotic translation initiation factor 3 subunit G OS=Dictyostelium discoideum GN=eif3G PE=3 SV=1 306 376 9.0E-07
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 306 379 1.0E-06
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 300 379 1.0E-06
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 275 367 1.0E-06
sp|Q642J5|RFOX1_DANRE RNA binding protein fox-1 homolog 1 OS=Danio rerio GN=rbfox1 PE=2 SV=1 301 382 2.0E-06
sp|Q6C747|EIF3G_YARLI Eukaryotic translation initiation factor 3 subunit G OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF35 PE=3 SV=1 306 376 2.0E-06
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 299 376 2.0E-06
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 306 376 2.0E-06
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 292 377 3.0E-06
sp|Q9NEW6|RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans GN=rsp-3 PE=1 SV=2 301 376 3.0E-06
sp|Q10572|FOX1_CAEEL Sex determination protein fox-1 OS=Caenorhabditis elegans GN=fox-1 PE=1 SV=2 277 382 3.0E-06
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 295 556 3.0E-06
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 293 388 3.0E-06
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 301 384 3.0E-06
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 305 385 4.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 306 376 4.0E-06
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 305 432 4.0E-06
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 305 382 4.0E-06
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 305 432 4.0E-06
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 303 380 4.0E-06
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 276 377 5.0E-06
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 304 384 5.0E-06
sp|Q7ZT82|RFX1L_DANRE RNA binding protein fox-1 homolog 1-like OS=Danio rerio GN=rbfox1l PE=1 SV=1 301 382 5.0E-06
sp|A4F5G6|RFOX2_XENLA RNA binding protein fox-1 homolog 2 OS=Xenopus laevis GN=rbfox2 PE=1 SV=1 245 382 7.0E-06
sp|Q2GSX8|PABP_CHAGB Polyadenylate-binding protein, cytoplasmic and nuclear OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAB1 PE=3 SV=1 304 376 8.0E-06
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 266 384 8.0E-06
sp|Q66JB7|RFOX2_XENTR RNA binding protein fox-1 homolog 2 OS=Xenopus tropicalis GN=rbfox2 PE=2 SV=1 285 382 9.0E-06
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 288 383 1.0E-05
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 291 556 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3505
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6369
Ophiocordyceps australis map64 (Brazil) OphauB2|4405
Ophiocordyceps camponoti-floridani Ophcf2|02258
Ophiocordyceps camponoti-rufipedis Ophun1|541 (this protein)
Ophiocordyceps kimflemingae Ophio5|1124
Ophiocordyceps subramaniannii Hirsu2|6716

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|541
MATSRIFIKGLPPNMTEAEMRKHFSAHDGHITDVKLIPQRRICYLGFKSSQDAARAVKFFNKSFIRLSRISVEPA
KPISDPTLGKRHEAPRSIQGTAQPTNDGDTNPKKRKRPEPTRPDPKLREFLSVMNFGAQGMVGGELNIDPAEGHE
TAEPAAVEDASDDEYEQMPKSRRVCSRTDGGAVAPPRDEGDDGADQARPSTSPGEKAAEAVDPATSDRKGPATEA
TDDDWLRSRTSRLLDLVEPEDLTNHSAPRPADGVATQDMDVCRDSVHSSEQVTHDTVGGDADMSEITNGDPVDAI
SKTSRLFVRNLPYDATEDDIRDTFDKFGALQEVHVPTNAAGSGKGFALVLFTDASDAVKAFQALDGATFQGRIMH
IIPATAKKQAGLDEFGISKLSLRKQKLVRKKAEASSTSFSWNSLYMSQDAVNSAVAQRLGVSKSELLDPTSAEAA
VKQAVAETTVIQETKAYFAANGVDLEAFKSQKRGDTAILVKNFPHGTSLEELRRLFEEYGPVLRVLMPPSGTIAI
VQFAQASHAKAAFGKLAYRRIRDSVLFLERAPKDVLIKADDVTGSPRVAGVQKLSVDELLSGGAAAEQAETSSLF
IRNLSFATSTSRPRRTPRRQARR*
Coding >Ophun1|541
ATGGCCACCTCGAGGATCTTCATCAAGGGCCTGCCGCCAAACATGACAGAAGCCGAGATGCGCAAACACTTCTCA
GCCCATGACGGACACATCACCGACGTCAAGCTCATCCCACAGCGCCGCATCTGCTATCTCGGCTTCAAGAGCTCA
CAGGATGCTGCCCGGGCCGTCAAGTTCTTCAACAAATCCTTTATTCGACTGTCGAGAATCTCCGTTGAACCCGCA
AAGCCCATCTCAGACCCGACGCTCGGCAAACGCCACGAAGCACCCCGTTCTATTCAGGGAACTGCCCAGCCGACA
AACGACGGGGATACGAACCCCAAGAAGCGGAAGCGTCCAGAGCCCACTCGGCCGGATCCAAAGCTGCGCGAGTTC
CTCAGCGTCATGAACTTCGGCGCCCAAGGGATGGTTGGAGGCGAATTAAACATTGATCCAGCCGAGGGGCACGAG
ACCGCGGAACCAGCCGCCGTGGAGGATGCCAGTGACGACGAGTATGAGCAGATGCCCAAGTCGAGGAGGGTGTGT
TCTCGGACAGACGGCGGCGCCGTTGCGCCACCAAGGGATGAAGGTGACGACGGCGCAGACCAGGCCCGCCCGTCA
ACAAGCCCCGGAGAGAAAGCAGCCGAGGCTGTTGATCCAGCGACAAGTGACAGAAAGGGCCCGGCCACAGAAGCC
ACCGACGATGATTGGCTGCGCTCACGCACCAGCAGGCTTCTGGATCTTGTCGAACCCGAAGACCTCACCAACCAC
TCGGCGCCAAGGCCTGCTGATGGAGTCGCAACGCAAGACATGGACGTCTGTCGAGACAGCGTCCATTCCTCGGAA
CAGGTGACGCATGATACCGTCGGTGGCGACGCCGACATGTCGGAAATTACCAACGGCGACCCGGTGGATGCGATA
TCCAAGACGTCTCGGCTCTTCGTCCGCAACCTGCCCTACGACGCCACCGAGGACGACATCCGCGACACGTTTGAC
AAGTTTGGGGCACTGCAAGAGGTACATGTGCCCACCAACGCGGCGGGATCTGGCAAGGGATTCGCTCTCGTATTG
TTTACCGATGCGTCAGACGCGGTCAAGGCATTCCAAGCACTGGATGGGGCGACGTTCCAGGGGCGTATCATGCAC
ATCATTCCAGCCACGGCCAAGAAACAGGCGGGACTGGACGAGTTCGGCATTTCTAAGTTGTCGCTACGGAAACAG
AAGCTGGTGCGCAAGAAGGCGGAGGCTTCGTCGACAAGCTTTAGCTGGAATTCTCTGTACATGAGCCAGGACGCC
GTCAACTCGGCCGTGGCCCAGCGGCTAGGTGTTTCAAAGTCGGAGCTGTTGGACCCGACGTCTGCCGAGGCGGCC
GTCAAGCAGGCCGTGGCAGAGACGACGGTGATCCAGGAGACCAAGGCCTACTTCGCCGCCAACGGCGTGGACCTC
GAGGCCTTCAAGTCGCAGAAGCGGGGCGACACGGCGATCCTGGTCAAGAACTTCCCGCATGGCACGAGCCTGGAG
GAGCTGCGGAGGCTGTTCGAGGAGTACGGCCCCGTCCTCAGGGTGCTGATGCCGCCGAGTGGGACAATCGCCATT
GTGCAGTTTGCGCAGGCCAGCCACGCAAAGGCTGCCTTTGGCAAGCTCGCCTATCGACGCATCCGGGATAGCGTG
CTGTTCCTCGAGAGGGCCCCCAAGGACGTGCTGATCAAGGCCGATGATGTGACAGGCAGTCCCAGGGTGGCAGGG
GTCCAGAAGCTAAGCGTTGACGAGCTGCTGTCAGGCGGCGCGGCGGCGGAGCAGGCGGAAACATCATCGCTCTTC
ATCCGCAATTTAAGCTTCGCCACGAGCACTAGCAGACCAAGGCGGACCCCAAGAAGGCAGGCCAGACGTTGA
Transcript >Ophun1|541
ATGGCCACCTCGAGGATCTTCATCAAGGGCCTGCCGCCAAACATGACAGAAGCCGAGATGCGCAAACACTTCTCA
GCCCATGACGGACACATCACCGACGTCAAGCTCATCCCACAGCGCCGCATCTGCTATCTCGGCTTCAAGAGCTCA
CAGGATGCTGCCCGGGCCGTCAAGTTCTTCAACAAATCCTTTATTCGACTGTCGAGAATCTCCGTTGAACCCGCA
AAGCCCATCTCAGACCCGACGCTCGGCAAACGCCACGAAGCACCCCGTTCTATTCAGGGAACTGCCCAGCCGACA
AACGACGGGGATACGAACCCCAAGAAGCGGAAGCGTCCAGAGCCCACTCGGCCGGATCCAAAGCTGCGCGAGTTC
CTCAGCGTCATGAACTTCGGCGCCCAAGGGATGGTTGGAGGCGAATTAAACATTGATCCAGCCGAGGGGCACGAG
ACCGCGGAACCAGCCGCCGTGGAGGATGCCAGTGACGACGAGTATGAGCAGATGCCCAAGTCGAGGAGGGTGTGT
TCTCGGACAGACGGCGGCGCCGTTGCGCCACCAAGGGATGAAGGTGACGACGGCGCAGACCAGGCCCGCCCGTCA
ACAAGCCCCGGAGAGAAAGCAGCCGAGGCTGTTGATCCAGCGACAAGTGACAGAAAGGGCCCGGCCACAGAAGCC
ACCGACGATGATTGGCTGCGCTCACGCACCAGCAGGCTTCTGGATCTTGTCGAACCCGAAGACCTCACCAACCAC
TCGGCGCCAAGGCCTGCTGATGGAGTCGCAACGCAAGACATGGACGTCTGTCGAGACAGCGTCCATTCCTCGGAA
CAGGTGACGCATGATACCGTCGGTGGCGACGCCGACATGTCGGAAATTACCAACGGCGACCCGGTGGATGCGATA
TCCAAGACGTCTCGGCTCTTCGTCCGCAACCTGCCCTACGACGCCACCGAGGACGACATCCGCGACACGTTTGAC
AAGTTTGGGGCACTGCAAGAGGTACATGTGCCCACCAACGCGGCGGGATCTGGCAAGGGATTCGCTCTCGTATTG
TTTACCGATGCGTCAGACGCGGTCAAGGCATTCCAAGCACTGGATGGGGCGACGTTCCAGGGGCGTATCATGCAC
ATCATTCCAGCCACGGCCAAGAAACAGGCGGGACTGGACGAGTTCGGCATTTCTAAGTTGTCGCTACGGAAACAG
AAGCTGGTGCGCAAGAAGGCGGAGGCTTCGTCGACAAGCTTTAGCTGGAATTCTCTGTACATGAGCCAGGACGCC
GTCAACTCGGCCGTGGCCCAGCGGCTAGGTGTTTCAAAGTCGGAGCTGTTGGACCCGACGTCTGCCGAGGCGGCC
GTCAAGCAGGCCGTGGCAGAGACGACGGTGATCCAGGAGACCAAGGCCTACTTCGCCGCCAACGGCGTGGACCTC
GAGGCCTTCAAGTCGCAGAAGCGGGGCGACACGGCGATCCTGGTCAAGAACTTCCCGCATGGCACGAGCCTGGAG
GAGCTGCGGAGGCTGTTCGAGGAGTACGGCCCCGTCCTCAGGGTGCTGATGCCGCCGAGTGGGACAATCGCCATT
GTGCAGTTTGCGCAGGCCAGCCACGCAAAGGCTGCCTTTGGCAAGCTCGCCTATCGACGCATCCGGGATAGCGTG
CTGTTCCTCGAGAGGGCCCCCAAGGACGTGCTGATCAAGGCCGATGATGTGACAGGCAGTCCCAGGGTGGCAGGG
GTCCAGAAGCTAAGCGTTGACGAGCTGCTGTCAGGCGGCGCGGCGGCGGAGCAGGCGGAAACATCATCGCTCTTC
ATCCGCAATTTAAGCTTCGCCACGAGCACTAGCAGACCAAGGCGGACCCCAAGAAGGCAGGCCAGACGTTGA
Gene >Ophun1|541
ATGGCCACCTCGAGGATCTTCATCAAGGGCCTGCCGCCAAACATGACAGAAGCCGAGATGCGCAAACACTTCTCA
GCCCATGACGGACACATCACCGACGTCAAGCTCATCCCACAGCGCCGCATCTGCTATCTCGGCTTCAAGAGCTCA
CAGGATGCTGCCCGGGCCGTCAAGTTCTTCAACAAATCCTTTATTCGACTGTCGAGAATCTCCGTTGAACCCGCA
AAGCCCGTACGGCACCCGTCGGGCCCCTCTCCCCACTGCAATTTGCTGATGGAATGCTAGATCTCAGACCCGACG
CTCGGCAAACGCCACGAAGCACCCCGTTCTATTCAGGGAACTGCCCAGCCGACAAACGACGGGGATACGAACCCC
AAGAAGCGGAAGCGTCCAGAGCCCACTCGGCCGGATCCAAAGCTGCGCGAGTTCCTCAGCGTCATGAACTTCGGC
GCCCAAGGGATGGTTGGAGGCGAATTAAACATTGATCCAGCCGAGGGGCACGAGACCGCGGAACCAGCCGCCGTG
GAGGATGCCAGTGACGACGAGTATGAGCAGATGCCCAAGTCGAGGAGGGTGTGTTCTCGGACAGACGGCGGCGCC
GTTGCGCCACCAAGGGATGAAGGTGACGACGGCGCAGACCAGGCCCGCCCGTCAACAAGCCCCGGAGAGAAAGCA
GCCGAGGCTGTTGATCCAGCGACAAGTGACAGAAAGGGCCCGGCCACAGAAGCCACCGACGATGATTGGCTGCGC
TCACGCACCAGCAGGCTTCTGGATCTTGTCGAACCCGAAGACCTCACCAACCACTCGGCGCCAAGGCCTGCTGAT
GGAGTCGCAACGCAAGACATGGACGTCTGTCGAGACAGCGTCCATTCCTCGGAACAGGTGACGCATGATACCGTC
GGTGGCGACGCCGACATGTCGGAAATTACCAACGGCGACCCGGTGGATGCGATATCCAAGACGTCTCGGCTCTTC
GTCCGCAACCTGCCCTACGACGCCACCGAGGACGACATCCGCGACACGTTTGACAAGTTTGGGGCACTGCAAGAG
GTACGTCCCGTCTGTACGACGTGATGATGAGCACACTCCCCCCCCCCCCTCTCCCCACCGTCCTCTCGCACGCAC
ACCTGGCGCCATGATGAAGCCCAAGATAGGGACAGCTTATGCCGATGGCATATGATGTGAACTCTGGGCGAGTAT
TTTTGTAGATGGCTCGATTTTCTGACGTGCCACGAGGTGTGCGTGCAAGACGGGGCGTTGATATTGAGTGACGGA
CGACCTAATCTTCGCGGCCTGGCTAACGTGGAAGACGACAGGTACATGTGCCCACCAACGCGGCGGGATCTGGCA
AGGGATTCGCTCTCGTATTGTTTACCGATGCGTCAGACGCGGTCAAGGCATTCCAAGCACTGGATGGGGCGACGT
TCCAGGGGCGTATCATGCACATCATTCCAGCCACGGCCAAGAAACAGGCGGGACTGGACGAGTTCGGCATTTCTA
AGTTGTCGCTACGGAAACAGAAGCTGGTGCGCAAGAAGGCGGAGGCTTCGTCGACAAGCTTTAGCTGGAATTCTC
TGTACATGAGCCAGGACGCCGTCAACTCGGCCGTGGCCCAGCGGCTAGGTGTTTCAAAGTCGGAGCTGTTGGACC
CGACGTCTGCCGAGGCGGCCGTCAAGCAGGCCGTGGCAGAGACGACGGTGATCCAGGAGACCAAGGCCTACTTCG
CCGCCAACGGCGTGGACCTCGAGGCCTTCAAGTCGCAGAAGCGGGGCGACACGGCGATCCTGGTCAAGAACTTCC
CGCATGGCACGAGCCTGGAGGAGCTGCGGAGGCTGTTCGAGGAGTACGGCCCCGTCCTCAGGGTGCTGATGCCGC
CGAGTGGGACAATCGCCATTGTGCAGTTTGCGCAGGCCAGCCACGCAAAGGCTGCCTTTGGCAAGCTCGCCTATC
GACGCATCCGGGATAGCGTGCTGTTCCTCGAGAGGGCCCCCAAGGACGTGCTGATCAAGGCCGATGATGTGACAG
GCAGTCCCAGGGTGGCAGGGGTCCAGAAGCTAAGCGTTGACGAGCTGCTGTCAGGCGGCGCGGCGGCGGAGCAGG
CGGAAACATCATCGCTCTTCATCCGCAATTTAAGCTTCGCCACGAGCACTAGCAGGTTGGCAGAAGCTTTCAAGC
CGCTCGACGGATTTGTCTCAGCCCGTGTCAAGACCAAGGCGGACCCCAAGAAGGCAGGCCAGACGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail