Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5407
Gene name
LocationContig_533:53..1723
Strand+
Gene length (bp)1670
Transcript length (bp)1596
Coding sequence length (bp)1596
Protein length (aa) 532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 4.1E-64 25 470
PF00324 AA_permease Amino acid permease 8.2E-32 39 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 4 489 5.0E-87
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 2 522 1.0E-81
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 7 489 1.0E-79
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 18 486 4.0E-66
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 9 491 4.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 4 489 5.0E-87
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 2 522 1.0E-81
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 7 489 1.0E-79
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 18 486 4.0E-66
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 9 491 4.0E-65
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 8 489 4.0E-63
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 10 489 3.0E-59
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 2 531 2.0E-56
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 2 530 2.0E-52
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 4 526 4.0E-46
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 3 529 8.0E-45
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 9 495 1.0E-40
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 9 466 2.0E-39
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 5 469 6.0E-36
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 18 475 4.0E-31
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 1 475 3.0E-29
sp|P0AA47|PLAP_ECOLI Low-affinity putrescine importer PlaP OS=Escherichia coli (strain K12) GN=plaP PE=1 SV=1 18 348 1.0E-10
sp|P0AA48|PLAP_ECO57 Low-affinity putrescine importer PlaP OS=Escherichia coli O157:H7 GN=plaP PE=3 SV=1 18 348 1.0E-10
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 54 370 1.0E-07
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 6 449 5.0E-07
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 79 409 3.0E-06
sp|Q8GYB4|CAAT3_ARATH Cationic amino acid transporter 3, mitochondrial OS=Arabidopsis thaliana GN=CAT3 PE=2 SV=1 79 364 3.0E-06
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 18 423 3.0E-06
sp|Q797A7|YFNA_BACSU Uncharacterized amino acid permease YfnA OS=Bacillus subtilis (strain 168) GN=yfnA PE=3 SV=1 79 417 5.0E-06
sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=2 SV=1 70 409 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 60 93 33
3 113 135 22
4 150 169 19
5 176 198 22
6 225 247 22
7 260 282 22
8 309 331 22
9 364 386 22
10 390 412 22
11 425 447 22
12 462 481 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5407
MEDPRLTADQALANLGYRAELPRTFSMLSILGLSFAIMAVPFGLSTTLYITLTNGQSVTVLYGWILVSLISLCIA
ASLAEICAVFPTAGGVYYWSATLSPRRWAPLVSFVDGWLTLVGNWTVTLSINFSGAQLILSAVTIFKPDFVANQL
ETVVCFWALMLVCALVNAFGSRHLGLVNSLCLYWTAATVLIILVTLLATSQHRRDAAFVFAHYDASASGWPSGWS
FFVGLLQPAYTLTGYGMVASMCEEVQNPQREVPRAIVLSVVVAGLTGIVYLIPLLFVLPDVKMLLQVANSQPIGL
LFKTVTGSAAAGFGLLFLILGILLFAGIGALTAASRCTYAFARDGAIPGHRLWSRVNKRLDMPLWALALSTLVDC
LLGCIYFGSSAAFNSFTGVATICLSTSYGVPVLVSLVRRRKHVRDSPYSLGRFGPLINAICLVWIVFAVVIFCMP
VALPVDASTMNYASVVFAAFATIAVAWYFAYARHNFTGPPVIKADLLDRGVTVGKTLRGAASNGAVSVSQDSEQT
SQKRKS*
Coding >Ophun1|5407
ATGGAAGACCCCCGCCTCACAGCAGACCAAGCCCTCGCAAACCTAGGCTACAGAGCCGAACTCCCCCGCACCTTC
AGCATGCTCTCCATCCTCGGCCTCTCCTTCGCCATCATGGCCGTCCCCTTCGGCCTCTCCACCACCCTCTACATC
ACCCTCACAAACGGCCAATCCGTAACCGTCCTCTACGGCTGGATCCTCGTCTCCCTCATCTCCCTCTGCATCGCC
GCCTCCCTCGCCGAAATCTGCGCCGTCTTCCCTACCGCCGGCGGCGTCTACTACTGGTCCGCGACCCTGAGTCCC
CGCCGCTGGGCTCCCCTCGTCAGCTTCGTCGACGGATGGCTCACCCTCGTTGGCAACTGGACCGTCACCCTCTCC
ATCAACTTCTCGGGCGCCCAGCTGATACTCAGCGCCGTCACCATCTTTAAACCCGACTTCGTCGCCAATCAGTTG
GAGACGGTCGTCTGCTTCTGGGCCCTCATGCTCGTCTGCGCCCTCGTCAACGCCTTCGGCTCTCGACATCTCGGC
CTCGTCAATAGTCTCTGTCTCTACTGGACGGCTGCTACCGTCCTCATCATTCTCGTCACCCTACTGGCCACGTCC
CAACATCGCCGCGACGCCGCCTTTGTCTTCGCCCACTACGATGCCTCTGCCAGCGGTTGGCCCAGCGGCTGGTCC
TTTTTCGTCGGCCTGCTTCAGCCCGCCTACACCCTCACCGGCTACGGCATGGTAGCCTCCATGTGCGAAGAAGTC
CAGAACCCCCAGCGCGAAGTCCCCCGAGCCATCGTCCTCTCCGTCGTCGTCGCCGGCCTCACGGGCATCGTCTAC
CTCATCCCCCTCCTCTTCGTCCTCCCCGACGTCAAGATGCTCCTCCAGGTGGCAAACTCGCAACCCATCGGCCTC
CTCTTCAAGACCGTCACCGGCTCAGCAGCCGCCGGCTTCGGCCTCCTCTTCCTCATCCTCGGCATCCTCCTCTTC
GCCGGCATCGGTGCCCTCACCGCCGCCTCCCGCTGCACCTACGCCTTCGCCCGAGACGGTGCCATCCCCGGTCAT
CGCCTCTGGAGTCGCGTCAACAAGAGGCTCGACATGCCGCTCTGGGCCCTCGCCTTGTCCACCCTCGTCGATTGC
CTGCTCGGCTGCATCTATTTCGGCTCCTCGGCCGCCTTCAACTCCTTCACCGGCGTCGCCACCATCTGCCTCTCC
ACCTCGTACGGCGTCCCCGTCCTCGTGAGCCTCGTCCGTCGCCGGAAGCACGTCCGCGACTCTCCCTACTCCCTC
GGCCGCTTCGGTCCCCTCATCAACGCCATCTGTCTCGTCTGGATCGTCTTTGCCGTCGTCATCTTCTGCATGCCC
GTTGCCCTGCCCGTCGACGCCAGCACCATGAACTACGCCTCCGTCGTCTTTGCCGCCTTTGCCACCATCGCCGTC
GCCTGGTACTTTGCCTATGCGCGCCACAACTTCACCGGCCCGCCCGTCATCAAGGCCGACCTCCTCGACCGCGGC
GTCACCGTCGGCAAGACGCTCAGGGGTGCCGCCAGCAACGGCGCCGTCTCCGTCTCCCAGGATTCGGAACAGACG
TCGCAAAAAAGAAAGTCGTAG
Transcript >Ophun1|5407
ATGGAAGACCCCCGCCTCACAGCAGACCAAGCCCTCGCAAACCTAGGCTACAGAGCCGAACTCCCCCGCACCTTC
AGCATGCTCTCCATCCTCGGCCTCTCCTTCGCCATCATGGCCGTCCCCTTCGGCCTCTCCACCACCCTCTACATC
ACCCTCACAAACGGCCAATCCGTAACCGTCCTCTACGGCTGGATCCTCGTCTCCCTCATCTCCCTCTGCATCGCC
GCCTCCCTCGCCGAAATCTGCGCCGTCTTCCCTACCGCCGGCGGCGTCTACTACTGGTCCGCGACCCTGAGTCCC
CGCCGCTGGGCTCCCCTCGTCAGCTTCGTCGACGGATGGCTCACCCTCGTTGGCAACTGGACCGTCACCCTCTCC
ATCAACTTCTCGGGCGCCCAGCTGATACTCAGCGCCGTCACCATCTTTAAACCCGACTTCGTCGCCAATCAGTTG
GAGACGGTCGTCTGCTTCTGGGCCCTCATGCTCGTCTGCGCCCTCGTCAACGCCTTCGGCTCTCGACATCTCGGC
CTCGTCAATAGTCTCTGTCTCTACTGGACGGCTGCTACCGTCCTCATCATTCTCGTCACCCTACTGGCCACGTCC
CAACATCGCCGCGACGCCGCCTTTGTCTTCGCCCACTACGATGCCTCTGCCAGCGGTTGGCCCAGCGGCTGGTCC
TTTTTCGTCGGCCTGCTTCAGCCCGCCTACACCCTCACCGGCTACGGCATGGTAGCCTCCATGTGCGAAGAAGTC
CAGAACCCCCAGCGCGAAGTCCCCCGAGCCATCGTCCTCTCCGTCGTCGTCGCCGGCCTCACGGGCATCGTCTAC
CTCATCCCCCTCCTCTTCGTCCTCCCCGACGTCAAGATGCTCCTCCAGGTGGCAAACTCGCAACCCATCGGCCTC
CTCTTCAAGACCGTCACCGGCTCAGCAGCCGCCGGCTTCGGCCTCCTCTTCCTCATCCTCGGCATCCTCCTCTTC
GCCGGCATCGGTGCCCTCACCGCCGCCTCCCGCTGCACCTACGCCTTCGCCCGAGACGGTGCCATCCCCGGTCAT
CGCCTCTGGAGTCGCGTCAACAAGAGGCTCGACATGCCGCTCTGGGCCCTCGCCTTGTCCACCCTCGTCGATTGC
CTGCTCGGCTGCATCTATTTCGGCTCCTCGGCCGCCTTCAACTCCTTCACCGGCGTCGCCACCATCTGCCTCTCC
ACCTCGTACGGCGTCCCCGTCCTCGTGAGCCTCGTCCGTCGCCGGAAGCACGTCCGCGACTCTCCCTACTCCCTC
GGCCGCTTCGGTCCCCTCATCAACGCCATCTGTCTCGTCTGGATCGTCTTTGCCGTCGTCATCTTCTGCATGCCC
GTTGCCCTGCCCGTCGACGCCAGCACCATGAACTACGCCTCCGTCGTCTTTGCCGCCTTTGCCACCATCGCCGTC
GCCTGGTACTTTGCCTATGCGCGCCACAACTTCACCGGCCCGCCCGTCATCAAGGCCGACCTCCTCGACCGCGGC
GTCACCGTCGGCAAGACGCTCAGGGGTGCCGCCAGCAACGGCGCCGTCTCCGTCTCCCAGGATTCGGAACAGACG
TCGCAAAAAAGAAAGTCGTAG
Gene >Ophun1|5407
ATGGAAGACCCCCGCCTCACAGCAGACCAAGCCCTCGCAAACCTAGGCTACAGAGCCGAACTCCCCCGCACCTTC
AGCATGCTCTCCATCCTCGGCCTCTCCTTCGCCATCATGGCCGTCCCCTTCGGCCTCTCCACCACCCTCTACATC
ACCCTCACAAACGGCCAATCCGTAACCGTCCTCTACGGCTGGATCCTCGTCTCCCTCATCTCCCTCTGCATCGCC
GCCTCCCTCGCCGAAATCTGCGCCGTCTTCCCTACCGCCGGCGGCGTCTACTACTGGTCCGCGACCCTGAGTCCC
CGCCGCTGGGCTCCCCTCGTCAGCTTCGTCGACGGATGGCTCACCCTCGTTGGCAACTGGACCGTCACCCTCTCC
ATCAACTTCTCGGGCGCCCAGCTGATACTCAGCGCCGTCACCATCTTTAAACCCGACTTCGTCGCCAATCAGTTG
GAGACGGTCGTCTGCTTCTGGGCCCTCATGCTCGTCTGCGCCCTCGTCAACGCCTTCGGCTCTCGACATCTCGGC
CTCGTCAATAGTCTCTGTCTCTACTGGACGGCTGCTACCGTCCTCATCATTCTCGTCACCCTACTGGCCACGTCC
CAACATCGCCGCGACGCCGCCTTTGTCTTCGCCCACTACGATGCCTCTGCCAGCGGTTGGCCCAGCGGCTGGTCC
TTTTTCGTCGGCCTGCTTCAGCGTGAGCATCATCATCATCATCGTCATCTAACTGACAACTGTTCATCATGACTG
ACTCAACTTCCCCCCCCCCAGCCGCCTACACCCTCACCGGCTACGGCATGGTAGCCTCCATGTGCGAAGAAGTCC
AGAACCCCCAGCGCGAAGTCCCCCGAGCCATCGTCCTCTCCGTCGTCGTCGCCGGCCTCACGGGCATCGTCTACC
TCATCCCCCTCCTCTTCGTCCTCCCCGACGTCAAGATGCTCCTCCAGGTGGCAAACTCGCAACCCATCGGCCTCC
TCTTCAAGACCGTCACCGGCTCAGCAGCCGCCGGCTTCGGCCTCCTCTTCCTCATCCTCGGCATCCTCCTCTTCG
CCGGCATCGGTGCCCTCACCGCCGCCTCCCGCTGCACCTACGCCTTCGCCCGAGACGGTGCCATCCCCGGTCATC
GCCTCTGGAGTCGCGTCAACAAGAGGCTCGACATGCCGCTCTGGGCCCTCGCCTTGTCCACCCTCGTCGATTGCC
TGCTCGGCTGCATCTATTTCGGCTCCTCGGCCGCCTTCAACTCCTTCACCGGCGTCGCCACCATCTGCCTCTCCA
CCTCGTACGGCGTCCCCGTCCTCGTGAGCCTCGTCCGTCGCCGGAAGCACGTCCGCGACTCTCCCTACTCCCTCG
GCCGCTTCGGTCCCCTCATCAACGCCATCTGTCTCGTCTGGATCGTCTTTGCCGTCGTCATCTTCTGCATGCCCG
TTGCCCTGCCCGTCGACGCCAGCACCATGAACTACGCCTCCGTCGTCTTTGCCGCCTTTGCCACCATCGCCGTCG
CCTGGTACTTTGCCTATGCGCGCCACAACTTCACCGGCCCGCCCGTCATCAAGGCCGACCTCCTCGACCGCGGCG
TCACCGTCGGCAAGACGCTCAGGGGTGCCGCCAGCAACGGCGCCGTCTCCGTCTCCCAGGATTCGGAACAGACGT
CGCAAAAAAGAAAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail