Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5400
Gene name
LocationContig_531:10322..11760
Strand+
Gene length (bp)1438
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04884 UVB_sens_prot Vitamin B6 photo-protection and homoeostasis 5.6E-86 62 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86K80|RUS1_DICDI RUS1 family protein homolog OS=Dictyostelium discoideum GN=DDB_G0277179 PE=3 SV=1 68 316 4.0E-51
sp|Q84JB8|RUS3_ARATH Protein root UVB sensitive 3 OS=Arabidopsis thaliana GN=RUS3 PE=2 SV=1 66 329 5.0E-44
sp|Q499P8|RUS1_RAT RUS1 family protein C16orf58 homolog OS=Rattus norvegicus PE=2 SV=1 70 320 3.0E-43
sp|Q91W34|RUS1_MOUSE RUS1 family protein C16orf58 homolog OS=Mus musculus PE=1 SV=1 70 320 1.0E-42
sp|Q5R8F6|RUS1_PONAB RUS1 family protein C16orf58 homolog OS=Pongo abelii PE=2 SV=1 70 320 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86K80|RUS1_DICDI RUS1 family protein homolog OS=Dictyostelium discoideum GN=DDB_G0277179 PE=3 SV=1 68 316 4.0E-51
sp|Q84JB8|RUS3_ARATH Protein root UVB sensitive 3 OS=Arabidopsis thaliana GN=RUS3 PE=2 SV=1 66 329 5.0E-44
sp|Q499P8|RUS1_RAT RUS1 family protein C16orf58 homolog OS=Rattus norvegicus PE=2 SV=1 70 320 3.0E-43
sp|Q91W34|RUS1_MOUSE RUS1 family protein C16orf58 homolog OS=Mus musculus PE=1 SV=1 70 320 1.0E-42
sp|Q5R8F6|RUS1_PONAB RUS1 family protein C16orf58 homolog OS=Pongo abelii PE=2 SV=1 70 320 1.0E-39
sp|Q96GQ5|RUS1_HUMAN RUS1 family protein C16orf58 OS=Homo sapiens GN=C16orf58 PE=1 SV=2 70 320 4.0E-39
sp|Q7X6P3|RUS1_ARATH Protein root UVB sensitive 1, chloroplastic OS=Arabidopsis thaliana GN=RUS1 PE=1 SV=1 74 312 1.0E-19
sp|Q9SJX7|RUS2_ARATH Protein root UVB sensitive 2, chloroplastic OS=Arabidopsis thaliana GN=RUS2 PE=1 SV=2 70 334 5.0E-19
sp|B6IDH3|RUS5_ARATH Protein root UVB sensitive 5 OS=Arabidopsis thaliana GN=RUS5 PE=2 SV=1 69 322 1.0E-15
sp|Q93YU2|RUS6_ARATH Protein root UVB sensitive 6 OS=Arabidopsis thaliana GN=RUS6 PE=2 SV=1 75 314 1.0E-15
sp|Q67YT8|RUS4_ARATH Protein root UVB sensitive 4 OS=Arabidopsis thaliana GN=RUS4 PE=2 SV=1 66 314 1.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5400
MPRHRRFDLADLGLPNSSPGFAHLVRSNSDVTVVQVSKSGHDAKLWTRSAAGRILAIRRQGTAKSWAKVIMAAFL
PVDFPNSVSSDYLAYQTYDSLQAFFSTITSLLASRALLQGLGVGDANSSATFAMLLTIMRDAVSNVVTIVFAHRF
GLSIEPEAKKYRFLADLFNDSAFFLELYSPHLGSWAKAMALCSAEGLRAVCGVAAGASKAALSLHFAKNDNLSEL
SAKEASQETAVSLVGLLVGTVVVRAVQDHSLVVCLVVALSLAHLWTNYCGVRSVCMTSVNKQRATILFDAYLRSS
TVLTPRQVAESERIVFWDGLMRNARHEPVLRILYAKSFGDAMNNGARDIIAVDGPMHTSFIRPYAPGRPGTIKIL
LWEGASAEHAILAWFMAMDTAWTTTADAPYGDAGLEKKIWTPRARDDLLWTNLEARGWDLGTAAMETGPGVRLSV
ERSGCKSE*
Coding >Ophun1|5400
ATGCCTCGCCACCGCAGGTTCGACCTCGCAGACCTCGGCCTTCCCAACTCCAGCCCCGGCTTCGCCCACCTCGTC
CGCTCCAACTCCGACGTCACCGTCGTCCAAGTCTCGAAATCAGGCCACGATGCCAAGCTCTGGACGCGATCTGCC
GCTGGCCGCATCCTCGCCATCCGGCGTCAAGGCACGGCCAAGAGCTGGGCCAAAGTCATCATGGCCGCCTTCTTG
CCCGTCGACTTCCCAAATTCGGTGTCGAGCGACTATCTCGCGTACCAGACGTACGATTCGCTGCAGGCCTTCTTC
TCTACCATTACGTCGCTGCTCGCTAGTCGTGCTCTGCTGCAGGGTCTGGGCGTGGGCGATGCCAACTCCTCGGCT
ACGTTTGCCATGCTGCTGACCATCATGCGCGATGCCGTTTCCAACGTCGTCACCATCGTCTTTGCCCATCGGTTT
GGGCTGAGCATCGAGCCCGAGGCCAAGAAGTATCGCTTTCTCGCTGATCTCTTCAACGACTCGGCCTTCTTCCTC
GAGCTTTACAGTCCTCATCTCGGGTCTTGGGCCAAGGCTATGGCTCTCTGCTCGGCCGAGGGGTTGCGTGCCGTC
TGTGGCGTCGCGGCCGGGGCTAGCAAGGCGGCCCTGAGCTTGCACTTTGCCAAGAACGATAATCTTTCGGAGCTG
AGCGCAAAGGAGGCCAGTCAGGAGACGGCCGTCAGCCTCGTTGGTCTGCTGGTCGGCACCGTGGTCGTCCGTGCC
GTTCAGGATCACAGCCTGGTCGTCTGTCTGGTCGTGGCCTTGTCGCTGGCTCATCTCTGGACCAACTATTGCGGC
GTGCGCAGCGTCTGCATGACGTCGGTGAACAAGCAGCGAGCCACCATCCTCTTTGACGCATATCTGCGATCGTCG
ACGGTCCTCACCCCTCGTCAGGTGGCCGAGAGCGAGCGCATCGTCTTCTGGGACGGTCTCATGCGCAACGCTCGC
CACGAACCCGTCCTACGCATCCTCTACGCCAAGAGCTTCGGCGACGCCATGAACAACGGCGCCCGGGATATCATC
GCCGTCGACGGGCCCATGCACACCAGCTTCATCCGGCCCTACGCCCCGGGTCGGCCGGGTACTATCAAGATCCTG
CTCTGGGAGGGCGCGTCTGCCGAGCACGCCATCCTCGCTTGGTTCATGGCCATGGACACGGCCTGGACGACGACG
GCCGATGCCCCGTACGGAGATGCGGGGCTCGAGAAGAAGATCTGGACGCCTCGTGCGCGCGACGACTTGCTGTGG
ACCAACTTGGAGGCCCGCGGCTGGGATCTGGGCACGGCCGCTATGGAGACGGGGCCGGGTGTCCGGCTCAGCGTT
GAGAGGTCGGGGTGCAAAAGCGAATAG
Transcript >Ophun1|5400
ATGCCTCGCCACCGCAGGTTCGACCTCGCAGACCTCGGCCTTCCCAACTCCAGCCCCGGCTTCGCCCACCTCGTC
CGCTCCAACTCCGACGTCACCGTCGTCCAAGTCTCGAAATCAGGCCACGATGCCAAGCTCTGGACGCGATCTGCC
GCTGGCCGCATCCTCGCCATCCGGCGTCAAGGCACGGCCAAGAGCTGGGCCAAAGTCATCATGGCCGCCTTCTTG
CCCGTCGACTTCCCAAATTCGGTGTCGAGCGACTATCTCGCGTACCAGACGTACGATTCGCTGCAGGCCTTCTTC
TCTACCATTACGTCGCTGCTCGCTAGTCGTGCTCTGCTGCAGGGTCTGGGCGTGGGCGATGCCAACTCCTCGGCT
ACGTTTGCCATGCTGCTGACCATCATGCGCGATGCCGTTTCCAACGTCGTCACCATCGTCTTTGCCCATCGGTTT
GGGCTGAGCATCGAGCCCGAGGCCAAGAAGTATCGCTTTCTCGCTGATCTCTTCAACGACTCGGCCTTCTTCCTC
GAGCTTTACAGTCCTCATCTCGGGTCTTGGGCCAAGGCTATGGCTCTCTGCTCGGCCGAGGGGTTGCGTGCCGTC
TGTGGCGTCGCGGCCGGGGCTAGCAAGGCGGCCCTGAGCTTGCACTTTGCCAAGAACGATAATCTTTCGGAGCTG
AGCGCAAAGGAGGCCAGTCAGGAGACGGCCGTCAGCCTCGTTGGTCTGCTGGTCGGCACCGTGGTCGTCCGTGCC
GTTCAGGATCACAGCCTGGTCGTCTGTCTGGTCGTGGCCTTGTCGCTGGCTCATCTCTGGACCAACTATTGCGGC
GTGCGCAGCGTCTGCATGACGTCGGTGAACAAGCAGCGAGCCACCATCCTCTTTGACGCATATCTGCGATCGTCG
ACGGTCCTCACCCCTCGTCAGGTGGCCGAGAGCGAGCGCATCGTCTTCTGGGACGGTCTCATGCGCAACGCTCGC
CACGAACCCGTCCTACGCATCCTCTACGCCAAGAGCTTCGGCGACGCCATGAACAACGGCGCCCGGGATATCATC
GCCGTCGACGGGCCCATGCACACCAGCTTCATCCGGCCCTACGCCCCGGGTCGGCCGGGTACTATCAAGATCCTG
CTCTGGGAGGGCGCGTCTGCCGAGCACGCCATCCTCGCTTGGTTCATGGCCATGGACACGGCCTGGACGACGACG
GCCGATGCCCCGTACGGAGATGCGGGGCTCGAGAAGAAGATCTGGACGCCTCGTGCGCGCGACGACTTGCTGTGG
ACCAACTTGGAGGCCCGCGGCTGGGATCTGGGCACGGCCGCTATGGAGACGGGGCCGGGTGTCCGGCTCAGCGTT
GAGAGGTCGGGGTGCAAAAGCGAATAG
Gene >Ophun1|5400
ATGCCTCGCCACCGCAGGTTCGACCTCGCAGACCTCGGCCTTCCCAACTCCAGCCCCGGCTTCGCCCACCTCGTC
CGCTCCAACTCCGACGTCACCGTCGTCCAAGTCTCGAAATCAGGCCACGATGCCAAGCTCTGGACGCGATCTGCC
GCTGGCCGCATCCTCGCCGTCCGTAGACGCACTCTTCTTCGTCGCGACCACTCCGCAAAGCTCACAATGATGCCC
CTAGATCCGGCGTCAAGGCACGGCCAAGAGCTGGGCCAAAGTCATCATGGCCGCCTTCTTGCCCGTCGACTTCCC
AAATTCGGTGTCGAGCGACTATCTCGCGTACCAGACGTACGATTCGCTGCAGGCCTTCTTCTCTACCATTACGTC
GCTGCTCGCTAGTCGTGCTCTGCTGCAGGGTCTGGGCGTGGGCGATGCCAACTCCTCGGCTACGTTTGCCATGCT
GCTGACCATCATGCGCGATGCCGTTTCCAACGTCGTCACCATCGTCTTTGCCCATCGGTTTGGGCTGAGCATCGA
GCCCGAGGCCAAGAAGTATCGCTTTCTCGCTGATCTCTTCAACGACTCGGCCTTCTTCCTCGAGCTTTACAGTCC
TCATCTCGGGTCTTGGGCCAAGGCTATGGCTCTCTGCTCGGCCGAGGGGTTGCGTGCCGTCTGTGGCGTCGCGGC
CGGGGCTAGCAAGGCGGCCCTGAGCTTGCACTTTGCCAAGAACGATAATCTTTCGGAGCTGAGCGCAAAGGAGGC
CAGTCAGGAGACGGCCGTCAGCCTCGTTGGTCTGCTGGTCGGCACCGTGGTCGTCCGTGCCGTTCAGGATCACAG
CCTGGTCGTCTGTCTGGTCGTGGCCTTGTCGCTGGCTCATCTCTGGACCAACTATTGCGGCGTGCGCAGCGTCTG
CATGACGTCGGTGAACAAGCAGCGAGCCACCATCCTCTTTGACGCATATCTGCGATCGTCGACGGTCCTCACCCC
TCGTCAGGTGGCCGAGAGCGAGCGCATCGTCTTCTGGGACGGTCTCATGCGCAACGCTCGCCACGAACCCGTCCT
ACGCATCCTCTACGCCAAGAGCTTCGGCGACGCCATGAACAACGGCGCCCGGGATATCATCGCCGTCGACGGGCC
CATGCACACCAGCTTCATCCGGCCCTACGCCCCGGGTCGGCCGGGTACTATCAAGATCCTGCTCTGGGAGGGCGC
GTCTGCCGAGCACGCCATCCTCGCTTGGTTCATGGCCATGGACACGGCCTGGACGACGACGGCCGATGCCCCGTA
CGGAGATGCGGGGCTCGAGAAGAAGATCTGGACGCCTCGTGCGCGCGACGACTTGCTGTGGACCAACTTGGAGGC
CCGCGGCTGGGATCTGGGCACGGCCGCTATGGAGACGGGGCCGGGTGTCCGGCTCAGCGTTGAGAGGTCGGGGTG
CAAAAGCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail