Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5391
Gene name
LocationContig_530:3982..4955
Strand+
Gene length (bp)973
Transcript length (bp)861
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.2E-11 157 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03687|YMP0_YEAST Uncharacterized membrane protein YMR010W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR010W PE=1 SV=1 11 235 8.0E-26
sp|Q5M880|PQLC1_RAT PQ-loop repeat-containing protein 1 OS=Rattus norvegicus GN=Pqlc1 PE=1 SV=2 3 236 6.0E-25
sp|Q8N2U9|PQLC1_HUMAN PQ-loop repeat-containing protein 1 OS=Homo sapiens GN=PQLC1 PE=1 SV=1 17 236 8.0E-25
sp|Q80XM9|PQLC1_MOUSE PQ-loop repeat-containing protein 1 OS=Mus musculus GN=Pqlc1 PE=1 SV=1 3 236 4.0E-24
sp|Q0VCC1|PQLC1_BOVIN PQ-loop repeat-containing protein 1 OS=Bos taurus GN=PQLC1 PE=2 SV=1 17 237 8.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03687|YMP0_YEAST Uncharacterized membrane protein YMR010W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR010W PE=1 SV=1 11 235 8.0E-26
sp|Q5M880|PQLC1_RAT PQ-loop repeat-containing protein 1 OS=Rattus norvegicus GN=Pqlc1 PE=1 SV=2 3 236 6.0E-25
sp|Q8N2U9|PQLC1_HUMAN PQ-loop repeat-containing protein 1 OS=Homo sapiens GN=PQLC1 PE=1 SV=1 17 236 8.0E-25
sp|Q80XM9|PQLC1_MOUSE PQ-loop repeat-containing protein 1 OS=Mus musculus GN=Pqlc1 PE=1 SV=1 3 236 4.0E-24
sp|Q0VCC1|PQLC1_BOVIN PQ-loop repeat-containing protein 1 OS=Bos taurus GN=PQLC1 PE=2 SV=1 17 237 8.0E-24
sp|Q6NRS2|PQLC1_XENLA PQ-loop repeat-containing protein 1 OS=Xenopus laevis GN=pqlc1 PE=2 SV=1 1 249 4.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 38 60 22
3 70 88 18
4 131 153 22
5 158 180 22
6 187 209 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5391
MSGWLAACAGYVAPLFIVMSPILSYGDQAMSMHRAKSSAGFSLDIPLIMLVASFFRIFYWHGARFDTSLLLQSLI
MVGMQLVLLKIALDNRPGPSSKGGESSLPFQQENLLSIQRPFDFWQWRSPKPYWQFLVYLVCVLMAFEVVLAAMP
PVYALWSATLGYVGLSVEATLAIPQILANSQARSCKGFRLSVLIAWLGGDALKILWFFTSTTDIPVAFKVCGIFQ
AACDCLLGVQYMQYGDGERRIMDHPLEEGRWSSAVMVPERPHSRSFSQTKAGVIYSDAEVD*
Coding >Ophun1|5391
ATGAGCGGCTGGCTCGCCGCCTGCGCTGGCTACGTCGCGCCTCTCTTCATCGTCATGTCGCCTATTCTCTCCTAT
GGCGATCAGGCAATGTCGATGCACCGCGCCAAGTCCAGCGCTGGCTTCTCGCTTGATATCCCCCTCATCATGCTC
GTCGCCTCCTTCTTCCGCATCTTTTACTGGCACGGCGCCCGATTCGATACCAGCCTGCTGCTGCAATCGCTCATC
ATGGTCGGCATGCAACTCGTCCTCCTCAAAATCGCCCTCGACAACCGGCCCGGGCCCTCGTCCAAGGGCGGCGAG
TCGAGCTTGCCCTTTCAACAGGAGAACCTGCTGTCCATCCAGCGGCCCTTTGACTTTTGGCAATGGCGTTCCCCC
AAGCCATACTGGCAATTTCTCGTCTACCTCGTCTGCGTCCTCATGGCCTTCGAAGTCGTCCTAGCCGCCATGCCC
CCCGTATACGCCCTCTGGTCCGCAACGCTAGGCTACGTAGGCCTCTCGGTCGAGGCGACGCTGGCCATTCCCCAG
ATCCTAGCCAACTCGCAGGCCCGCTCGTGCAAGGGCTTTCGGCTTTCGGTGCTGATCGCCTGGCTGGGCGGCGAT
GCCCTCAAGATCCTCTGGTTCTTCACCTCGACCACCGACATCCCCGTCGCCTTCAAAGTCTGCGGCATCTTCCAG
GCTGCCTGCGACTGCCTGCTGGGCGTACAATACATGCAGTACGGAGACGGAGAGCGCCGCATCATGGATCATCCG
CTCGAGGAGGGCCGCTGGTCCAGCGCCGTCATGGTGCCTGAGAGGCCTCATAGTCGGAGCTTTTCCCAGACCAAG
GCGGGCGTCATCTACTCGGATGCCGAGGTGGATTAG
Transcript >Ophun1|5391
ATGAGCGGCTGGCTCGCCGCCTGCGCTGGCTACGTCGCGCCTCTCTTCATCGTCATGTCGCCTATTCTCTCCTAT
GGCGATCAGGCAATGTCGATGCACCGCGCCAAGTCCAGCGCTGGCTTCTCGCTTGATATCCCCCTCATCATGCTC
GTCGCCTCCTTCTTCCGCATCTTTTACTGGCACGGCGCCCGATTCGATACCAGCCTGCTGCTGCAATCGCTCATC
ATGGTCGGCATGCAACTCGTCCTCCTCAAAATCGCCCTCGACAACCGGCCCGGGCCCTCGTCCAAGGGCGGCGAG
TCGAGCTTGCCCTTTCAACAGGAGAACCTGCTGTCCATCCAGCGGCCCTTTGACTTTTGGCAATGGCGTTCCCCC
AAGCCATACTGGCAATTTCTCGTCTACCTCGTCTGCGTCCTCATGGCCTTCGAAGTCGTCCTAGCCGCCATGCCC
CCCGTATACGCCCTCTGGTCCGCAACGCTAGGCTACGTAGGCCTCTCGGTCGAGGCGACGCTGGCCATTCCCCAG
ATCCTAGCCAACTCGCAGGCCCGCTCGTGCAAGGGCTTTCGGCTTTCGGTGCTGATCGCCTGGCTGGGCGGCGAT
GCCCTCAAGATCCTCTGGTTCTTCACCTCGACCACCGACATCCCCGTCGCCTTCAAAGTCTGCGGCATCTTCCAG
GCTGCCTGCGACTGCCTGCTGGGCGTACAATACATGCAGTACGGAGACGGAGAGCGCCGCATCATGGATCATCCG
CTCGAGGAGGGCCGCTGGTCCAGCGCCGTCATGGTGCCTGAGAGGCCTCATAGTCGGAGCTTTTCCCAGACCAAG
GCGGGCGTCATCTACTCGGATGCCGAGGTGGATTAG
Gene >Ophun1|5391
ATGAGCGGCTGGCTCGCCGCCTGCGCTGGCTACGTCGCGCCTCTCTTCATCGTCATGTCGCCTATTCTCTCCTAT
GGCGATCAGGCAATGTCGATGCACCGCGCCAAGTCCAGCGCTGGCTTCTCGCTTGATATCCCCCTCATCATGCTC
GTCGCCTCCTTCTTCCGGTCCGTCTCTGCTTCACGCCCGTGGGAGATACGCATGCTGACTTCTTACAGCATCTTT
TACTGGCACGGCGCCCGATTCGATACCAGCCTGCTGCTGCAATCGCTCATCATGGTCGGCATGCAACTCGTCCTC
CTCAAAATCGCCCTCGACAACCGGCCCGGGCCCTCGTCCAAGGGCGGCGAGTCGAGCTTGCCCTTTCAACAGGAG
AACCTGCTGTCCATCCAGCGGCCCTTTGACTTTTGGCAATGGCGTTCCCCCAAGCCGTGAGTCTCTCTCTCTCTC
CCTCTCTCTCCAGCTCGTCCACATGCTCAACTGCTACTCCAGATACTGGCAATTTCTCGTCTACCTCGTCTGCGT
CCTCATGGCCTTCGAAGTCGTCCTAGCCGCCATGCCCCCCGTATACGCCCTCTGGTCCGCAACGCTAGGCTACGT
AGGCCTCTCGGTCGAGGCGACGCTGGCCATTCCCCAGATCCTAGCCAACTCGCAGGCCCGCTCGTGCAAGGGCTT
TCGGCTTTCGGTGCTGATCGCCTGGCTGGGCGGCGATGCCCTCAAGATCCTCTGGTTCTTCACCTCGACCACCGA
CATCCCCGTCGCCTTCAAAGTCTGCGGCATCTTCCAGGCTGCCTGCGACTGCCTGCTGGGCGTACAATACATGCA
GTACGGAGACGGAGAGCGCCGCATCATGGATCATCCGCTCGAGGAGGGCCGCTGGTCCAGCGCCGTCATGGTGCC
TGAGAGGCCTCATAGTCGGAGCTTTTCCCAGACCAAGGCGGGCGTCATCTACTCGGATGCCGAGGTGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail