Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5368
Gene name
LocationContig_528:2771..4967
Strand+
Gene length (bp)2196
Transcript length (bp)2127
Coding sequence length (bp)2127
Protein length (aa) 709

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 7.9E-18 327 655

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2R2|CCR4_NEUCR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccr4 PE=3 SV=2 1 688 0.0E+00
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 1 694 0.0E+00
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 1 687 0.0E+00
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 1 687 0.0E+00
sp|Q0U7W4|CCR4_PHANO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CCR4 PE=3 SV=2 175 694 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2R2|CCR4_NEUCR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccr4 PE=3 SV=2 1 688 0.0E+00
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 1 694 0.0E+00
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 1 687 0.0E+00
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 1 687 0.0E+00
sp|Q0U7W4|CCR4_PHANO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CCR4 PE=3 SV=2 175 694 0.0E+00
sp|A1CIJ6|CCR4_ASPCL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccr4 PE=3 SV=1 55 694 0.0E+00
sp|Q2UUI3|CCR4_ASPOR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ccr4 PE=3 SV=1 1 679 0.0E+00
sp|A1CW67|CCR4_NEOFI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ccr4 PE=3 SV=1 1 687 0.0E+00
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 55 694 0.0E+00
sp|Q4WQG5|CCR4_ASPFU Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccr4 PE=3 SV=1 1 694 0.0E+00
sp|Q4P9T3|CCR4_USTMA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCR4 PE=3 SV=1 160 682 9.0E-157
sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr4 PE=3 SV=1 155 685 3.0E-154
sp|Q6CEJ6|CCR4_YARLI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCR4 PE=3 SV=1 151 707 3.0E-147
sp|P0CP23|CCR4_CRYNB Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCR4 PE=3 SV=1 150 683 4.0E-136
sp|P0CP22|CCR4_CRYNJ Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCR4 PE=3 SV=1 150 683 4.0E-136
sp|Q6BMM5|CCR4_DEBHA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCR4 PE=3 SV=2 84 703 2.0E-135
sp|Q5A761|CCR4_CANAL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCR4 PE=3 SV=1 87 690 4.0E-133
sp|Q75BI3|CCR4_ASHGO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCR4 PE=3 SV=1 151 679 1.0E-111
sp|Q6CJU4|CCR4_KLULA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCR4 PE=3 SV=1 151 681 5.0E-110
sp|P31384|CCR4_YEAST Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCR4 PE=1 SV=2 151 679 3.0E-108
sp|Q6FRT2|CCR4_CANGA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCR4 PE=3 SV=1 151 679 4.0E-108
sp|Q8VEG6|CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus GN=Cnot6l PE=1 SV=2 153 678 6.0E-91
sp|Q9ULM6|CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens GN=CNOT6 PE=1 SV=2 156 679 2.0E-88
sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcription complex subunit 6-like OS=Danio rerio GN=cnot6l PE=2 SV=1 153 679 1.0E-87
sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis GN=cnot6 PE=1 SV=1 156 679 9.0E-86
sp|Q96LI5|CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens GN=CNOT6L PE=1 SV=2 153 678 1.0E-85
sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus GN=Cnot6 PE=2 SV=1 156 679 1.0E-84
sp|Q8K3P5|CNOT6_MOUSE CCR4-NOT transcription complex subunit 6 OS=Mus musculus GN=Cnot6 PE=1 SV=2 156 679 1.0E-84
sp|Q5XH73|CN6LB_XENLA CCR4-NOT transcription complex subunit 6-like-B OS=Xenopus laevis GN=cnot6l-b PE=2 SV=1 153 679 7.0E-83
sp|Q6IR85|CN6LA_XENLA CCR4-NOT transcription complex subunit 6-like-A OS=Xenopus laevis GN=cnot6l-a PE=2 SV=1 153 679 2.0E-82
sp|B7XK66|CCR4_ENTBH Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Enterocytozoon bieneusi (strain H348) GN=CCR4 PE=3 SV=1 153 686 3.0E-74
sp|C4V7I7|CCR4_NOSCE Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Nosema ceranae (strain BRL01) GN=CCR4 PE=3 SV=1 151 682 1.0E-71
sp|Q8SU52|CCR4_ENCCU Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCR4 PE=3 SV=1 166 694 5.0E-67
sp|Q8W0Z9|CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana GN=CCR4-1 PE=2 SV=1 263 687 7.0E-37
sp|Q9M2F8|CCR4B_ARATH Carbon catabolite repressor protein 4 homolog 2 OS=Arabidopsis thaliana GN=CCR4-2 PE=2 SV=2 325 687 5.0E-34
sp|Q6AXQ5|PDE12_RAT 2',5'-phosphodiesterase 12 OS=Rattus norvegicus GN=Pde12 PE=2 SV=1 323 679 4.0E-26
sp|A8MS41|CCR4D_ARATH Carbon catabolite repressor protein 4 homolog 4 OS=Arabidopsis thaliana GN=CCR4-4 PE=1 SV=1 322 682 4.0E-26
sp|Q3TIU4|PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus GN=Pde12 PE=1 SV=2 323 679 5.0E-26
sp|Q6L8Q7|PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens GN=PDE12 PE=1 SV=2 323 679 7.0E-26
sp|Q08DF7|PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus GN=PDE12 PE=1 SV=1 323 679 1.0E-24
sp|Q9ET55|NOCT_RAT Nocturnin OS=Rattus norvegicus GN=Noct PE=2 SV=2 303 679 1.0E-23
sp|Q9LS39|CCR4C_ARATH Carbon catabolite repressor protein 4 homolog 3 OS=Arabidopsis thaliana GN=CCR4-3 PE=2 SV=2 316 682 2.0E-23
sp|O35710|NOCT_MOUSE Nocturnin OS=Mus musculus GN=Noct PE=1 SV=3 288 679 7.0E-23
sp|Q9UK39|NOCT_HUMAN Nocturnin OS=Homo sapiens GN=NOCT PE=2 SV=2 303 679 5.0E-21
sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homolog 5 OS=Arabidopsis thaliana GN=CCR4-5 PE=2 SV=2 313 679 1.0E-20
sp|Q5RGT6|ANGE2_DANRE Protein angel homolog 2 OS=Danio rerio GN=angel2 PE=2 SV=1 323 679 5.0E-20
sp|P79942|NOCT_XENLA Nocturnin OS=Xenopus laevis GN=noct PE=1 SV=1 323 679 2.0E-18
sp|A6H7I3|ANGE2_BOVIN Protein angel homolog 2 OS=Bos taurus GN=ANGEL2 PE=2 SV=1 309 580 2.0E-15
sp|Q8VYU4|CCR4F_ARATH Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana GN=CCR4-6 PE=2 SV=2 317 580 2.0E-15
sp|Q5VTE6|ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens GN=ANGEL2 PE=2 SV=1 307 580 2.0E-15
sp|Q8K1C0|ANGE2_MOUSE Protein angel homolog 2 OS=Mus musculus GN=Angel2 PE=1 SV=1 323 580 2.0E-14
sp|Q8VCU0|ANGE1_MOUSE Protein angel homolog 1 OS=Mus musculus GN=Angel1 PE=1 SV=2 322 580 5.0E-13
sp|B2RYM0|ANGE1_RAT Protein angel homolog 1 OS=Rattus norvegicus GN=Angel1 PE=1 SV=2 322 580 7.0E-13
sp|Q9UNK9|ANGE1_HUMAN Protein angel homolog 1 OS=Homo sapiens GN=ANGEL1 PE=2 SV=1 322 580 7.0E-13
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 167 306 4.0E-11
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 181 274 7.0E-11
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 175 302 2.0E-10
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 187 295 7.0E-10
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 179 276 1.0E-09
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 182 385 1.0E-09
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 187 309 1.0E-09
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 187 295 2.0E-09
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 187 295 2.0E-09
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 187 295 2.0E-09
sp|Q9C0I9|LRC27_HUMAN Leucine-rich repeat-containing protein 27 OS=Homo sapiens GN=LRRC27 PE=2 SV=2 175 321 3.0E-09
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 172 274 5.0E-09
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 192 272 5.0E-09
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 167 273 7.0E-09
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 171 276 7.0E-09
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 82 276 7.0E-09
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 183 266 8.0E-09
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 187 295 9.0E-09
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 177 275 1.0E-08
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 195 276 1.0E-08
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 195 276 1.0E-08
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 175 274 1.0E-08
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 171 276 1.0E-08
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 172 275 2.0E-08
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 195 276 2.0E-08
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 175 275 2.0E-08
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 170 276 2.0E-08
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 183 266 2.0E-08
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 195 276 2.0E-08
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 195 276 2.0E-08
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 195 276 2.0E-08
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 172 275 2.0E-08
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 172 275 2.0E-08
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 172 276 2.0E-08
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 184 276 3.0E-08
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 173 266 3.0E-08
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 205 274 3.0E-08
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 159 286 3.0E-08
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 195 276 3.0E-08
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 172 275 3.0E-08
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 195 276 3.0E-08
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 175 275 3.0E-08
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 175 272 4.0E-08
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 172 275 4.0E-08
sp|Q24239|ANGEL_DROME Protein angel OS=Drosophila melanogaster GN=angel PE=1 SV=2 323 533 4.0E-08
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 172 275 4.0E-08
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 189 296 4.0E-08
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 172 275 4.0E-08
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 175 275 4.0E-08
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 172 275 4.0E-08
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 182 275 4.0E-08
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 172 275 4.0E-08
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 182 275 5.0E-08
sp|Q80YS5|LRC27_MOUSE Leucine-rich repeat-containing protein 27 OS=Mus musculus GN=Lrrc27 PE=2 SV=1 175 295 5.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 175 275 5.0E-08
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 172 275 5.0E-08
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 162 276 5.0E-08
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 191 285 6.0E-08
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 182 274 6.0E-08
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 167 292 7.0E-08
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 185 300 7.0E-08
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 175 274 7.0E-08
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 167 292 7.0E-08
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 195 275 7.0E-08
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 170 287 8.0E-08
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 162 276 1.0E-07
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 175 280 1.0E-07
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 160 276 1.0E-07
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 175 299 1.0E-07
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 188 274 2.0E-07
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 170 299 2.0E-07
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 175 276 2.0E-07
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 175 276 2.0E-07
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 175 336 2.0E-07
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 165 277 2.0E-07
sp|Q9S7I6|RPK2_ARATH LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=2 SV=1 206 302 2.0E-07
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 172 282 2.0E-07
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 177 274 2.0E-07
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 160 276 2.0E-07
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 195 268 2.0E-07
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 165 277 2.0E-07
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 170 287 2.0E-07
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 195 268 2.0E-07
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 170 287 2.0E-07
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 177 274 2.0E-07
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 175 274 3.0E-07
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 170 299 3.0E-07
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 170 299 3.0E-07
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 170 299 3.0E-07
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 170 299 3.0E-07
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 175 299 3.0E-07
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 195 275 3.0E-07
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 195 276 3.0E-07
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 195 276 3.0E-07
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 195 264 3.0E-07
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 175 266 4.0E-07
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 175 276 4.0E-07
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 175 276 4.0E-07
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 175 276 4.0E-07
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 188 299 4.0E-07
sp|Q8CI70|LRC20_MOUSE Leucine-rich repeat-containing protein 20 OS=Mus musculus GN=Lrrc20 PE=1 SV=1 173 279 4.0E-07
sp|Q9SKG5|SERK4_ARATH Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2 162 278 4.0E-07
sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2 162 278 4.0E-07
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 175 276 5.0E-07
sp|Q8LPS5|SERK5_ARATH Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2 162 278 5.0E-07
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 190 272 5.0E-07
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 175 275 6.0E-07
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 193 276 6.0E-07
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 188 299 6.0E-07
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 166 274 6.0E-07
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 195 276 7.0E-07
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 195 268 7.0E-07
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 177 275 7.0E-07
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 177 275 7.0E-07
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 175 274 8.0E-07
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 174 275 9.0E-07
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 177 276 1.0E-06
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 175 255 1.0E-06
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 175 274 1.0E-06
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 195 275 1.0E-06
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 192 276 1.0E-06
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 175 274 1.0E-06
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 177 276 1.0E-06
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 175 274 1.0E-06
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 195 268 1.0E-06
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 178 272 1.0E-06
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 177 276 1.0E-06
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 164 276 1.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 175 274 1.0E-06
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 174 282 1.0E-06
sp|O94294|SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sog2 PE=1 SV=1 182 272 1.0E-06
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 157 299 2.0E-06
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 175 264 2.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 162 274 2.0E-06
sp|A4IHG1|LRC58_XENTR Leucine-rich repeat-containing protein 58 OS=Xenopus tropicalis GN=lrrc58 PE=2 SV=1 154 302 2.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 172 276 2.0E-06
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 177 276 2.0E-06
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 175 282 3.0E-06
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 169 276 3.0E-06
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 160 284 3.0E-06
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 195 276 3.0E-06
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 175 276 3.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 175 274 3.0E-06
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 191 276 3.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 195 276 3.0E-06
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 195 274 3.0E-06
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 174 299 3.0E-06
sp|Q9LFG1|Y3359_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590 OS=Arabidopsis thaliana GN=At3g53590 PE=3 SV=2 184 277 3.0E-06
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 165 274 3.0E-06
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 175 272 3.0E-06
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 195 275 4.0E-06
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 182 274 4.0E-06
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 195 276 4.0E-06
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 188 274 4.0E-06
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 175 274 4.0E-06
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 168 276 4.0E-06
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 164 276 4.0E-06
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 170 275 4.0E-06
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 98 280 5.0E-06
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 169 276 5.0E-06
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 160 274 5.0E-06
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 195 299 5.0E-06
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 133 275 5.0E-06
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 175 274 5.0E-06
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 175 274 5.0E-06
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 160 272 5.0E-06
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 177 315 5.0E-06
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 160 274 5.0E-06
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 172 282 5.0E-06
sp|C0LGH8|Y1634_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g63430 OS=Arabidopsis thaliana GN=At1g63430 PE=2 SV=1 175 278 5.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 175 274 6.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 175 275 6.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 198 288 6.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 175 272 7.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 177 275 7.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 175 299 7.0E-06
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 195 276 7.0E-06
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 175 272 7.0E-06
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 175 276 7.0E-06
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 168 272 8.0E-06
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 175 274 8.0E-06
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 158 276 8.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 175 281 8.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 195 275 9.0E-06
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 195 274 9.0E-06
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 101 269 9.0E-06
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 175 272 9.0E-06
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 173 272 9.0E-06
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 195 278 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1822
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6193
Ophiocordyceps australis map64 (Brazil) OphauB2|6211
Ophiocordyceps camponoti-floridani Ophcf2|03418
Ophiocordyceps camponoti-rufipedis Ophun1|5368 (this protein)
Ophiocordyceps kimflemingae Ophio5|1715
Ophiocordyceps subramaniannii Hirsu2|1797

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5368
MYSQNHQQGHNARLNGGGRGMPNLIYNYQQHAQHQHPSQPQHHQGLQHDHGMPNSNGLGHHASFPSAVMANSSAF
NTNTLPNGHAGNARGNQGPHNELWQEQLRMHKESERAHSAMTDQQQPHYYARLKASENRGIGGPPLSNAKTLADG
ESDENDRRRPYNVEKEATRQDWHNMDMSGQGLRNLAPELFRYQFLNELYIASNKIGRLPKEIGELRQLRHLDASF
NQISELPPELGMCTYLKQLLLFNNNISELPFELGSLHLLDVLGIEGNPLEANLKQEMMEKGTKSLINALREGAPI
PPPPTTRREIVIQEDVSPSLERIKVFSWNVLCDKYATASTYGYTPTAALNWEYRRDCILEELRLRNADFLMLQEV
STDAFKEDLSPQLAQMDYKGVHWPKSRAKTMSEKDAQTVDGCAVFFKQSKYMLLDKQLIEFATIAINRPDMKNQH
DVFNRVMPKDNIAVICFFESRVTGARLILVNVHLTWDSALADVKVIQTGILMEHVTKLAEKYARWPAVKDKKMIT
LPASSAEEREAAAPQAEPGPSQEYRSNTEIPLLVCGDFNSTEDSSVYDLMSKGRVPPDHLELSSFHYGSFTRDGI
EHPFSLRDAYAHIKGTSDELPFTNYTPGFADVIDYIWYSTNTLEVVDLLGPPDAGYLKRMPAFPNWHFPADHIQI
MAEFVIKGRKEKKHAPERDPPDFGSGSGSASRG*
Coding >Ophun1|5368
ATGTACTCACAAAATCATCAACAAGGTCACAATGCGCGCCTTAACGGTGGGGGGCGCGGGATGCCGAACCTGATA
TACAACTACCAGCAACACGCTCAGCATCAGCACCCGTCCCAGCCCCAGCACCACCAGGGCCTTCAGCACGACCAT
GGCATGCCCAACTCTAACGGTCTCGGCCACCATGCATCCTTCCCCTCGGCCGTCATGGCCAACTCTTCGGCCTTC
AACACCAACACGCTGCCTAACGGGCATGCCGGAAACGCGCGTGGCAATCAGGGCCCTCACAACGAACTATGGCAA
GAACAGCTGCGAATGCACAAGGAGTCCGAACGAGCTCATTCAGCCATGACAGATCAACAACAACCTCACTACTAC
GCAAGACTAAAGGCCTCGGAGAATAGGGGAATCGGCGGTCCTCCTCTGTCCAACGCTAAGACCTTGGCAGACGGC
GAGAGCGACGAGAATGACCGCAGGAGGCCTTACAACGTCGAAAAGGAAGCGACGCGGCAGGACTGGCACAACATG
GACATGAGCGGTCAGGGGCTGCGCAACCTGGCCCCCGAGCTGTTTCGATATCAGTTCCTCAACGAACTGTACATT
GCTTCCAATAAGATCGGTCGACTCCCCAAGGAGATTGGCGAATTGCGACAGCTGCGCCACCTCGACGCTTCCTTC
AACCAGATCTCGGAGCTGCCTCCAGAGCTTGGCATGTGCACATATTTGAAGCAGCTGCTGCTGTTCAACAACAAC
ATCTCGGAGCTGCCTTTTGAGCTCGGATCACTTCATCTCCTGGATGTGCTCGGGATCGAGGGCAACCCGCTCGAG
GCCAACTTGAAGCAGGAGATGATGGAAAAGGGCACCAAGAGCCTGATTAACGCGTTGCGAGAGGGAGCACCCATC
CCTCCGCCGCCGACGACGCGTCGAGAAATCGTCATACAGGAAGACGTCTCGCCGAGCCTCGAGAGAATCAAGGTG
TTCTCTTGGAACGTGCTCTGCGACAAGTACGCGACGGCGTCGACGTACGGTTACACGCCCACGGCAGCTCTCAAC
TGGGAGTACCGCAGAGATTGCATCCTGGAGGAGCTGCGTCTCCGAAATGCCGACTTCCTGATGCTGCAAGAAGTG
TCAACGGATGCTTTCAAGGAAGACCTCAGCCCCCAGCTGGCGCAGATGGACTACAAGGGCGTGCATTGGCCCAAG
TCGCGAGCCAAGACCATGTCGGAGAAGGACGCGCAGACGGTCGACGGATGCGCCGTCTTCTTCAAGCAGAGCAAG
TACATGTTGCTCGACAAGCAGCTCATCGAGTTCGCCACCATCGCCATCAACCGGCCCGACATGAAGAACCAGCAC
GACGTCTTCAACCGCGTCATGCCCAAGGACAACATCGCCGTCATATGCTTCTTCGAGTCGCGCGTCACGGGCGCT
CGCCTGATACTGGTCAACGTCCACCTCACGTGGGACTCGGCTCTGGCCGACGTCAAGGTGATCCAGACGGGCATC
CTGATGGAGCACGTCACCAAGCTGGCCGAGAAGTACGCGCGCTGGCCGGCTGTCAAGGACAAGAAGATGATTACG
CTGCCGGCATCATCGGCAGAGGAGAGGGAGGCGGCCGCGCCGCAAGCGGAGCCGGGCCCGAGCCAAGAGTATCGC
AGCAACACGGAGATTCCGCTGCTGGTGTGCGGCGACTTCAACTCGACCGAGGACTCGTCCGTCTACGACCTCATG
TCCAAGGGCCGGGTGCCGCCCGATCACCTGGAGCTGAGCAGCTTTCACTACGGCAGCTTCACGCGCGACGGCATC
GAGCATCCCTTCAGCCTCCGCGACGCCTACGCCCACATCAAGGGCACGTCGGACGAGCTCCCCTTTACCAACTAC
ACGCCGGGCTTCGCCGACGTCATCGACTACATCTGGTACTCGACTAACACGCTCGAGGTGGTGGATCTGCTCGGT
CCGCCCGACGCCGGCTACCTCAAGCGCATGCCAGCCTTTCCCAACTGGCACTTCCCGGCCGATCACATCCAGATC
ATGGCCGAGTTCGTCATCAAGGGCCGCAAGGAGAAGAAGCACGCGCCCGAGCGGGATCCGCCCGATTTCGGGTCC
GGATCCGGCTCGGCATCGCGAGGCTGA
Transcript >Ophun1|5368
ATGTACTCACAAAATCATCAACAAGGTCACAATGCGCGCCTTAACGGTGGGGGGCGCGGGATGCCGAACCTGATA
TACAACTACCAGCAACACGCTCAGCATCAGCACCCGTCCCAGCCCCAGCACCACCAGGGCCTTCAGCACGACCAT
GGCATGCCCAACTCTAACGGTCTCGGCCACCATGCATCCTTCCCCTCGGCCGTCATGGCCAACTCTTCGGCCTTC
AACACCAACACGCTGCCTAACGGGCATGCCGGAAACGCGCGTGGCAATCAGGGCCCTCACAACGAACTATGGCAA
GAACAGCTGCGAATGCACAAGGAGTCCGAACGAGCTCATTCAGCCATGACAGATCAACAACAACCTCACTACTAC
GCAAGACTAAAGGCCTCGGAGAATAGGGGAATCGGCGGTCCTCCTCTGTCCAACGCTAAGACCTTGGCAGACGGC
GAGAGCGACGAGAATGACCGCAGGAGGCCTTACAACGTCGAAAAGGAAGCGACGCGGCAGGACTGGCACAACATG
GACATGAGCGGTCAGGGGCTGCGCAACCTGGCCCCCGAGCTGTTTCGATATCAGTTCCTCAACGAACTGTACATT
GCTTCCAATAAGATCGGTCGACTCCCCAAGGAGATTGGCGAATTGCGACAGCTGCGCCACCTCGACGCTTCCTTC
AACCAGATCTCGGAGCTGCCTCCAGAGCTTGGCATGTGCACATATTTGAAGCAGCTGCTGCTGTTCAACAACAAC
ATCTCGGAGCTGCCTTTTGAGCTCGGATCACTTCATCTCCTGGATGTGCTCGGGATCGAGGGCAACCCGCTCGAG
GCCAACTTGAAGCAGGAGATGATGGAAAAGGGCACCAAGAGCCTGATTAACGCGTTGCGAGAGGGAGCACCCATC
CCTCCGCCGCCGACGACGCGTCGAGAAATCGTCATACAGGAAGACGTCTCGCCGAGCCTCGAGAGAATCAAGGTG
TTCTCTTGGAACGTGCTCTGCGACAAGTACGCGACGGCGTCGACGTACGGTTACACGCCCACGGCAGCTCTCAAC
TGGGAGTACCGCAGAGATTGCATCCTGGAGGAGCTGCGTCTCCGAAATGCCGACTTCCTGATGCTGCAAGAAGTG
TCAACGGATGCTTTCAAGGAAGACCTCAGCCCCCAGCTGGCGCAGATGGACTACAAGGGCGTGCATTGGCCCAAG
TCGCGAGCCAAGACCATGTCGGAGAAGGACGCGCAGACGGTCGACGGATGCGCCGTCTTCTTCAAGCAGAGCAAG
TACATGTTGCTCGACAAGCAGCTCATCGAGTTCGCCACCATCGCCATCAACCGGCCCGACATGAAGAACCAGCAC
GACGTCTTCAACCGCGTCATGCCCAAGGACAACATCGCCGTCATATGCTTCTTCGAGTCGCGCGTCACGGGCGCT
CGCCTGATACTGGTCAACGTCCACCTCACGTGGGACTCGGCTCTGGCCGACGTCAAGGTGATCCAGACGGGCATC
CTGATGGAGCACGTCACCAAGCTGGCCGAGAAGTACGCGCGCTGGCCGGCTGTCAAGGACAAGAAGATGATTACG
CTGCCGGCATCATCGGCAGAGGAGAGGGAGGCGGCCGCGCCGCAAGCGGAGCCGGGCCCGAGCCAAGAGTATCGC
AGCAACACGGAGATTCCGCTGCTGGTGTGCGGCGACTTCAACTCGACCGAGGACTCGTCCGTCTACGACCTCATG
TCCAAGGGCCGGGTGCCGCCCGATCACCTGGAGCTGAGCAGCTTTCACTACGGCAGCTTCACGCGCGACGGCATC
GAGCATCCCTTCAGCCTCCGCGACGCCTACGCCCACATCAAGGGCACGTCGGACGAGCTCCCCTTTACCAACTAC
ACGCCGGGCTTCGCCGACGTCATCGACTACATCTGGTACTCGACTAACACGCTCGAGGTGGTGGATCTGCTCGGT
CCGCCCGACGCCGGCTACCTCAAGCGCATGCCAGCCTTTCCCAACTGGCACTTCCCGGCCGATCACATCCAGATC
ATGGCCGAGTTCGTCATCAAGGGCCGCAAGGAGAAGAAGCACGCGCCCGAGCGGGATCCGCCCGATTTCGGGTCC
GGATCCGGCTCGGCATCGCGAGGCTGA
Gene >Ophun1|5368
ATGTACTCACAAAATCATCAACAAGGTCACAATGCGCGCCTTAACGGTGGGGGGCGCGGGATGCCGAACCTGATA
TACAACTACCAGCAACACGCTCAGCATCAGCACCCGTCCCAGCCCCAGCACCACCAGGGCCTTCAGCACGACCAT
GGCATGCCCAACTCTAACGGTCTCGGCCACCATGCATCCTTCCCCTCGGCCGTCATGGCCAACTCTTCGGCCTTC
AACACCAACACGCTGCCTAACGGGCATGCCGGAAACGCGCGTGGCAATCAGGGCCCTCACAACGAACTATGGCAA
GAACAGCTGCGAATGCACAAGGAGTCCGAACGAGCTCATTCAGCCATGACAGATCAACAACAACCTCACTACTAC
GCAAGACTAAAGGCCTCGGAGAATAGGGGAATCGGCGGTCCTCCTCTGTCCAACGCTAAGACCTTGGCAGACGGC
GAGAGCGACGAGAATGACCGCAGGAGGCCTTACAACGTCGAAAAGGAAGCGACGCGGCAGGACTGGCACAACATG
GACATGAGCGGTCAGGGGCTGCGCAACCTGGCCCCCGAGCTGTTTCGATATCAGTTCCTCAACGAACTGTACATT
GCTTCCAATAAGATCGGTCGACTCCCCAAGGAGATTGGCGAATTGCGACAGCTGCGCCACCTCGACGCTTCCTTC
AACCAGATCTCGGAGCTGCCTCCAGAGCTTGGCATGTGCACATATTTGAAGCAGCTGCTGCTGTTCAACAACAAC
ATCTCGGAGCTGCCTTTTGAGCTCGGATCACTTCATCTCCTGGATGTGCTCGGGATCGAGGGCAACCCGCTCGAG
GCCAACTTGAAGCAGGAGATGATGGAAAAGGGCACCAAGAGCCTGATTAACGCGTTGCGAGAGGGAGCACCCAGT
GAGTATCACTTCTGTCACCTTGAACGAACAAGGAGAGAATGTGGACGCTAATGGATGCCTTGACCAGTCCCTCCG
CCGCCGACGACGCGTCGAGAAATCGTCATACAGGAAGACGTCTCGCCGAGCCTCGAGAGAATCAAGGTGTTCTCT
TGGAACGTGCTCTGCGACAAGTACGCGACGGCGTCGACGTACGGTTACACGCCCACGGCAGCTCTCAACTGGGAG
TACCGCAGAGATTGCATCCTGGAGGAGCTGCGTCTCCGAAATGCCGACTTCCTGATGCTGCAAGAAGTGTCAACG
GATGCTTTCAAGGAAGACCTCAGCCCCCAGCTGGCGCAGATGGACTACAAGGGCGTGCATTGGCCCAAGTCGCGA
GCCAAGACCATGTCGGAGAAGGACGCGCAGACGGTCGACGGATGCGCCGTCTTCTTCAAGCAGAGCAAGTACATG
TTGCTCGACAAGCAGCTCATCGAGTTCGCCACCATCGCCATCAACCGGCCCGACATGAAGAACCAGCACGACGTC
TTCAACCGCGTCATGCCCAAGGACAACATCGCCGTCATATGCTTCTTCGAGTCGCGCGTCACGGGCGCTCGCCTG
ATACTGGTCAACGTCCACCTCACGTGGGACTCGGCTCTGGCCGACGTCAAGGTGATCCAGACGGGCATCCTGATG
GAGCACGTCACCAAGCTGGCCGAGAAGTACGCGCGCTGGCCGGCTGTCAAGGACAAGAAGATGATTACGCTGCCG
GCATCATCGGCAGAGGAGAGGGAGGCGGCCGCGCCGCAAGCGGAGCCGGGCCCGAGCCAAGAGTATCGCAGCAAC
ACGGAGATTCCGCTGCTGGTGTGCGGCGACTTCAACTCGACCGAGGACTCGTCCGTCTACGACCTCATGTCCAAG
GGCCGGGTGCCGCCCGATCACCTGGAGCTGAGCAGCTTTCACTACGGCAGCTTCACGCGCGACGGCATCGAGCAT
CCCTTCAGCCTCCGCGACGCCTACGCCCACATCAAGGGCACGTCGGACGAGCTCCCCTTTACCAACTACACGCCG
GGCTTCGCCGACGTCATCGACTACATCTGGTACTCGACTAACACGCTCGAGGTGGTGGATCTGCTCGGTCCGCCC
GACGCCGGCTACCTCAAGCGCATGCCAGCCTTTCCCAACTGGCACTTCCCGGCCGATCACATCCAGATCATGGCC
GAGTTCGTCATCAAGGGCCGCAAGGAGAAGAAGCACGCGCCCGAGCGGGATCCGCCCGATTTCGGGTCCGGATCC
GGCTCGGCATCGCGAGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail