Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5363
Gene name
LocationContig_527:227..1633
Strand+
Gene length (bp)1406
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.1E-26 6 392

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 188 447 2.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 1 319 2.0E-10

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 81 103 22
4 110 132 22
5 137 159 22
6 222 253 31
7 268 290 22
8 311 333 22
9 343 365 22
10 378 397 19
11 412 430 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5363
MVTPGLIPLSEAFESQEKSVSLFTIGVVALWTTIGGHMTVAGSDVWGRRPFYVVSLGVLAFANFLASVTLSLPSL
VIMRAVSGLASAPFLLLTPASVADVFFAHERGMFLAALVAASYGGGQLGIVIAGFIVQAVGVSALFKISAAAYAA
LFVAAYFYLFETAPFPRDPPGCSNKHEDTFDLASEKPSSSHQESSPKQNSSRRIVFGRRLSNKSFIKGLIDPFLL
LILPAVAYSVIIFGVFLTLVISLPVLVVQIVGEPPYKLPPVQAGLICLPLAVISVVGGPLVGALMDVSARFMAGR
NRDIKGGLEPEFRLTTLLVCGPLTTGGLVGLSVSTSSRLPLQWVLFWLCVTYLGSMWTTQAVLVYVVDCLPALTG
QTFTLINLSAAIGIFIASDGLVRWELSSGTSTVCDDLAILSGLVLLPTVPIYVFGKRVRGKLARTKWTRSLYP*
Coding >Ophun1|5363
ATGGTCACCCCCGGCCTCATCCCCCTCTCAGAAGCCTTCGAAAGCCAAGAGAAATCCGTGTCGCTCTTCACCATC
GGCGTCGTCGCCCTCTGGACCACCATCGGAGGCCACATGACCGTCGCCGGCTCCGACGTCTGGGGAAGACGACCC
TTTTACGTCGTCAGCCTCGGCGTCTTGGCTTTTGCCAATTTCCTGGCTTCTGTTACGCTTTCGCTTCCTTCGCTT
GTTATCATGCGGGCTGTTTCTGGCTTGGCTTCGGCCCCGTTCTTGCTGCTTACCCCTGCCAGTGTTGCCGATGTC
TTTTTTGCTCATGAGCGTGGCATGTTTCTTGCTGCTTTAGTTGCTGCCTCGTATGGCGGTGGTCAGCTGGGAATC
GTCATCGCCGGCTTCATCGTTCAGGCTGTGGGTGTCTCTGCCCTGTTCAAGATCTCGGCTGCTGCATACGCAGCC
TTGTTTGTAGCCGCCTACTTCTATCTCTTCGAGACAGCCCCTTTCCCAAGAGACCCTCCAGGTTGCAGCAACAAA
CATGAGGATACCTTTGATCTTGCAAGTGAGAAGCCAAGCAGCTCTCATCAAGAATCTTCGCCAAAGCAGAACAGC
AGCCGGAGAATCGTCTTTGGCCGTCGTCTCAGCAATAAATCCTTCATCAAGGGACTCATAGACCCCTTTCTCCTC
CTCATCCTCCCCGCAGTCGCTTACTCCGTCATTATCTTCGGCGTATTCCTAACCCTAGTCATCAGCCTCCCCGTC
CTAGTCGTCCAGATCGTCGGCGAACCCCCCTACAAGCTCCCTCCCGTCCAAGCCGGCCTCATCTGTCTACCGCTG
GCCGTCATCTCCGTCGTCGGTGGGCCCTTGGTCGGGGCCTTGATGGACGTCTCTGCCCGGTTCATGGCCGGCAGA
AACAGGGACATCAAGGGAGGGCTGGAACCCGAGTTCCGGCTTACGACGCTGCTCGTTTGCGGGCCCCTGACTACG
GGAGGACTCGTCGGACTCAGTGTCAGCACCAGCAGCCGTCTGCCGCTTCAGTGGGTTCTCTTCTGGCTGTGCGTC
ACTTATCTGGGCTCCATGTGGACGACACAGGCGGTGCTGGTCTACGTCGTCGACTGTCTGCCTGCTCTGACGGGC
CAGACGTTTACCCTCATCAATCTCTCGGCCGCCATAGGCATCTTCATCGCGTCTGACGGCCTGGTTCGATGGGAG
CTATCGTCTGGGACGTCGACGGTATGCGACGACCTGGCCATCTTATCCGGCCTCGTCCTGCTGCCGACGGTTCCC
ATCTATGTGTTTGGAAAGAGAGTAAGGGGCAAGCTGGCGAGGACCAAATGGACGCGGTCTCTATATCCCTGA
Transcript >Ophun1|5363
ATGGTCACCCCCGGCCTCATCCCCCTCTCAGAAGCCTTCGAAAGCCAAGAGAAATCCGTGTCGCTCTTCACCATC
GGCGTCGTCGCCCTCTGGACCACCATCGGAGGCCACATGACCGTCGCCGGCTCCGACGTCTGGGGAAGACGACCC
TTTTACGTCGTCAGCCTCGGCGTCTTGGCTTTTGCCAATTTCCTGGCTTCTGTTACGCTTTCGCTTCCTTCGCTT
GTTATCATGCGGGCTGTTTCTGGCTTGGCTTCGGCCCCGTTCTTGCTGCTTACCCCTGCCAGTGTTGCCGATGTC
TTTTTTGCTCATGAGCGTGGCATGTTTCTTGCTGCTTTAGTTGCTGCCTCGTATGGCGGTGGTCAGCTGGGAATC
GTCATCGCCGGCTTCATCGTTCAGGCTGTGGGTGTCTCTGCCCTGTTCAAGATCTCGGCTGCTGCATACGCAGCC
TTGTTTGTAGCCGCCTACTTCTATCTCTTCGAGACAGCCCCTTTCCCAAGAGACCCTCCAGGTTGCAGCAACAAA
CATGAGGATACCTTTGATCTTGCAAGTGAGAAGCCAAGCAGCTCTCATCAAGAATCTTCGCCAAAGCAGAACAGC
AGCCGGAGAATCGTCTTTGGCCGTCGTCTCAGCAATAAATCCTTCATCAAGGGACTCATAGACCCCTTTCTCCTC
CTCATCCTCCCCGCAGTCGCTTACTCCGTCATTATCTTCGGCGTATTCCTAACCCTAGTCATCAGCCTCCCCGTC
CTAGTCGTCCAGATCGTCGGCGAACCCCCCTACAAGCTCCCTCCCGTCCAAGCCGGCCTCATCTGTCTACCGCTG
GCCGTCATCTCCGTCGTCGGTGGGCCCTTGGTCGGGGCCTTGATGGACGTCTCTGCCCGGTTCATGGCCGGCAGA
AACAGGGACATCAAGGGAGGGCTGGAACCCGAGTTCCGGCTTACGACGCTGCTCGTTTGCGGGCCCCTGACTACG
GGAGGACTCGTCGGACTCAGTGTCAGCACCAGCAGCCGTCTGCCGCTTCAGTGGGTTCTCTTCTGGCTGTGCGTC
ACTTATCTGGGCTCCATGTGGACGACACAGGCGGTGCTGGTCTACGTCGTCGACTGTCTGCCTGCTCTGACGGGC
CAGACGTTTACCCTCATCAATCTCTCGGCCGCCATAGGCATCTTCATCGCGTCTGACGGCCTGGTTCGATGGGAG
CTATCGTCTGGGACGTCGACGGTATGCGACGACCTGGCCATCTTATCCGGCCTCGTCCTGCTGCCGACGGTTCCC
ATCTATGTGTTTGGAAAGAGAGTAAGGGGCAAGCTGGCGAGGACCAAATGGACGCGGTCTCTATATCCCTGA
Gene >Ophun1|5363
ATGGTCACCCCCGGCCTCATCCCCCTCTCAGAAGCCTTCGAAAGCCAAGAGAAATCCGTGTCGCTCTTCACCATC
GGCGTCGTCGCCCTCTGGACCACCATCGGAGGCCACATGACCGTCGCCGGCTCCGACGTCTGGGGAAGACGACCC
TTTTACGTCGTCAGCCTCGGCGTCTTGGCTTTTGCCAATTTCCTGGCTTCTGTTACGCTTTCGCTTCCTTCGCTT
GTTATCATGCGGGCTGTTTCTGGCTTGGCTTCGGCCCCGTTCTTGCTGCTTACCCCTGCCAGTGTTGCCGATGTC
TTTTTTGCTCATGAGCGTGGCATGTTTCTTGCTGCTTTAGTTGCTGCCTCGTATGGCGGTGGTCAGCTGGGGTAT
GACTTTGAGATCTGTCTATTGCATGAGATGAACTGACATGGTTCTGAATCTGCAGAATCGTCATCGCCGGCTTCA
TCGTTCAGGCTGTGGGTGTCTCTGCCCTGTTCAAGATCTCGGCTGCTGCATACGCAGCCTTGTTTGTAGCCGCCT
ACTTCTATCTCTTCGAGACAGCCCCTTTCCCAAGAGACCCTCCAGGTTGCAGCAACAAACATGAGGATACCTTTG
ATCTTGCAAGTGAGAAGCCAAGCAGCTCTCATCAAGAATCTTCGCCAAAGCAGAACAGCAGCCGGAGAATCGTCT
TTGGCCGTCGTCTCAGCAATAAATCCTTCATCAAGGGACTCATAGACCCCTTTCTCCTCCTCATCCTCCCCGCAG
TCGCTTACTCCGTCATTATCTTCGGCGTATTCCTAACCCTAGTCATCAGCCTCCCCGTCCTAGTCGTCCAGATCG
TCGGCGAACCCCCCTACAAGCTCCCTCCCGTCCAAGCCGGCCTCATCTGTCTACCGCTGGCCGTCATCTCCGTCG
TCGGTGGGCCCTTGGTCGGGGCCTTGATGGACGTCTCTGCCCGGTTCATGGCCGGCAGAAACAGGGACATCAAGG
GAGGGCTGGAACCCGAGTTCCGGCTTACGACGCTGCTCGTTTGCGGGCCCCTGACTACGGGAGGACTCGTCGGAC
TCAGTGTCAGCACCAGCAGCCGTCTGCCGCTTCAGTGGGTTCTCTTCTGGCTGTGCGTCACTTATCTGGGCTCCA
TGTGGACGACACAGGCGGTGCTGGTCTACGTCGTCGACTGTCTGCCTGCTCTGACGGGCCAGACGTTTACCCTCA
TCAATCTCTCGGCCGCCATAGGCATCTTCATCGCGTCTGACGGCCTGGTTCGATGGGAGCTATCGTCTGGGACGT
CGACGGTATGCGACGACCTGGCCATCTTATCCGGCCTCGTCCTGCTGCCGACGGTTCCCATCTATGTGTTTGGAA
AGAGAGTAAGGGGCAAGCTGGCGAGGACCAAATGGACGCGGTCTCTATATCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail