Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5362
Gene name
LocationContig_526:9444..12879
Strand-
Gene length (bp)3435
Transcript length (bp)3243
Coding sequence length (bp)3243
Protein length (aa) 1081

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 3.6E-265 556 1062
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.6E-13 758 1002
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.2E-06 757 926

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 1080 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 8 1062 0.0E+00
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 1 1061 0.0E+00
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1 1061 0.0E+00
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1 1066 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 1080 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 8 1062 0.0E+00
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 1 1061 0.0E+00
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1 1061 0.0E+00
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1 1066 0.0E+00
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 59 1066 0.0E+00
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 576 1064 0.0E+00
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 1 1066 0.0E+00
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 579 1047 0.0E+00
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 583 1030 1.0E-157
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 581 1062 6.0E-134
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 581 1061 6.0E-129
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 22 416 3.0E-28
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 28 437 1.0E-20
sp|P04340|NODC_RHILV N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae GN=nodC PE=3 SV=1 748 933 1.0E-15
sp|P04341|NODC_RHIME N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) GN=nodC PE=3 SV=1 747 995 4.0E-15
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 754 1067 2.0E-14
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 758 972 2.0E-14
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 708 935 3.0E-14
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 758 929 4.0E-14
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 708 935 5.0E-14
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 706 972 5.0E-14
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 741 952 9.0E-14
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 56 417 1.0E-13
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 757 958 1.0E-13
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 751 979 2.0E-13
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 758 972 2.0E-13
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 757 1011 3.0E-13
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 731 928 7.0E-13
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 757 928 7.0E-13
sp|Q61647|HYAS1_MOUSE Hyaluronan synthase 1 OS=Mus musculus GN=Has1 PE=1 SV=1 584 933 9.0E-13
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 699 929 1.0E-12
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 741 972 2.0E-12
sp|P50356|NODC_RHIGA N-acetylglucosaminyltransferase OS=Rhizobium galegae GN=nodC PE=3 SV=1 747 933 3.0E-12
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 758 926 3.0E-12
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 736 927 3.0E-12
sp|Q92839|HYAS1_HUMAN Hyaluronan synthase 1 OS=Homo sapiens GN=HAS1 PE=1 SV=2 736 933 4.0E-12
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 757 928 6.0E-12
sp|O35776|HYAS2_RAT Hyaluronan synthase 2 OS=Rattus norvegicus GN=Has2 PE=2 SV=1 736 927 7.0E-12
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 736 927 9.0E-12
sp|G5AY81|HYAS2_HETGA Hyaluronan synthase 2 OS=Heterocephalus glaber GN=Has2 PE=3 SV=1 736 927 1.0E-11
sp|Q92819|HYAS2_HUMAN Hyaluronan synthase 2 OS=Homo sapiens GN=HAS2 PE=2 SV=1 736 927 1.0E-11
sp|P70312|HYAS2_MOUSE Hyaluronan synthase 2 OS=Mus musculus GN=Has2 PE=1 SV=4 736 927 1.0E-11
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 757 928 1.0E-11
sp|P26024|NODC_BRADU N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodC PE=3 SV=2 747 931 2.0E-11
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 758 929 3.0E-11
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 758 929 4.0E-11
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 741 929 4.0E-11
sp|O97711|HYAS2_BOVIN Hyaluronan synthase 2 OS=Bos taurus GN=HAS2 PE=2 SV=1 736 927 4.0E-11
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 758 997 5.0E-11
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 758 929 7.0E-11
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 758 929 8.0E-11
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 758 929 2.0E-10
sp|O57427|HYAS2_XENLA Hyaluronan synthase 2 OS=Xenopus laevis GN=has2 PE=2 SV=2 736 927 4.0E-10
sp|O57424|HYAS2_CHICK Hyaluronan synthase 2 OS=Gallus gallus GN=HAS2 PE=2 SV=2 736 927 4.0E-10
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 758 987 8.0E-10
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 757 928 2.0E-09
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 72 409 3.0E-08
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 757 1011 7.0E-08
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 757 929 9.0E-08
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 91 411 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 127 149 22
2 388 410 22
3 964 986 22
4 993 1015 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5362
MDVLPSSTGNDPILENLDGSTERSGGSLPNGSFTDSPPRRNDVNEHEKTLERTRTRQPKPTKITKPTKGERRPSR
KKQKVVENQLRPPSLWNVYCAIITFWCPDFVLRCFGKPTKAQRRAWREKMGLISIILFIMAIVGFLTFGFTATVC
RAPPLRLRTNEVSDGYMIFHGVAYDLASSHHPPARGIPLRQDGMGANVLFDLPEKHGGQDGSFLFQNVNGKCKGV
ITRAPGSDVPSNAADDLAWYFPCTIFNQDGSTAPNLTIPYYLGYACHTTQNARDAFYRDLSGAADVYFTWDDIKN
SSRNLIVYSGAVLDLNLLNWFNESQVSIPDRFKELRDTRSAVNRAVRGRDVTRLFQSSDDKRYAQCFEEIIKVGS
VDTETVGCIASKVVLYCALVLILSVVLARFMLALVFQWFISRNYAASKTSQSSNRRKRNQQIEAWSEDIYRAPAR
LPGDVGSTVASSNKRSSSFLPTTSRFSTVYGAERGGGGGGGGDRGGGVGGGGGHRRIPTTMTSQGASGSLLSPHS
IYRHGNDSRASFLRTETFGSSNMGEGPGPAGFIHDAVVPQPPSDWMPFGFPLAHTMCLVTAYSEGEEGIRTTLDS
IATTDYPNSHKAIVVICDGIIKGKGEAVSTPDVCLGMLRDHSTPPELVQPFSYVAVASGSKRHNMAKVYCGFYDY
GARSQIPADRQQRVPMMVIVKCGTPAEEAAKSKPGNRGKRDSQIILMSFLQKVMFDERMTELEYEMFNGLWKVTG
ISPDYYEIVLMVDADTKVFPDSLTHMVSAMVKDPEIMGLCGETKIANKRDSWVTAIQVFEYFVSHHLAKSFESVF
GGVTCLPGCFCMYRIKAPKGGQNYWVPILANPDIVEHYSENVVETLHEKNLYLLGEDRFLTTLMLRTFPKRKQVF
VPQAVCKTTVPDKFMVLLSQRRRWINSTIHNLMELVLVRDLCGTFCFSMQFVIFVELVGTLVLPAAIAFTFYVAL
ILGLPGVLIIVTAHSWSYVIWMMIYLLSLPVWNFVLPTYAFWKFDDFSWGDTRKTAGESSSSKKGGGGAGGHEDE
GEFDSSKITMKRGEWAVSPGQYHDEYHSDV*
Coding >Ophun1|5362
ATGGACGTCCTGCCCTCGTCCACCGGCAACGACCCCATCCTCGAGAACCTCGACGGCTCCACCGAGCGATCTGGC
GGCTCCCTGCCCAACGGGAGCTTCACCGACTCTCCCCCTCGTCGCAACGACGTCAACGAGCACGAAAAGACTCTC
GAGCGTACGAGGACTCGCCAGCCCAAGCCGACCAAGATTACCAAGCCGACAAAGGGAGAGCGTCGGCCTTCCCGT
AAGAAGCAAAAGGTCGTCGAGAATCAGCTGAGACCGCCGAGCCTGTGGAACGTCTACTGCGCCATCATCACCTTT
TGGTGCCCCGACTTCGTCTTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGGAGGGAAAAGATG
GGCCTCATCAGCATCATCCTCTTCATCATGGCCATTGTCGGCTTCCTGACCTTTGGCTTCACAGCCACCGTGTGT
CGCGCGCCTCCCTTGCGCCTCCGCACCAACGAGGTGTCGGACGGATACATGATCTTCCACGGCGTCGCCTACGAT
CTCGCCAGCTCCCACCACCCTCCCGCCCGAGGCATCCCCCTGCGCCAGGACGGCATGGGCGCCAACGTCCTCTTC
GATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAATGCAAGGGCGTC
ATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTTCCCTGCACCATC
TTCAACCAGGACGGTTCGACGGCGCCCAACCTCACGATCCCCTATTACCTCGGCTATGCCTGTCACACGACGCAA
AACGCCCGCGACGCCTTTTACCGCGATCTGAGCGGAGCCGCCGACGTCTACTTTACCTGGGACGACATCAAGAAC
AGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTCAACGAGAGCCAG
GTGTCCATCCCCGACCGCTTCAAGGAGCTGCGGGACACGCGCAGCGCCGTCAACAGGGCCGTCCGCGGCCGCGAC
GTCACGCGCCTCTTCCAGTCGTCGGATGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATCAAGGTCGGCTCC
GTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTCATCCTGTCGGTG
GTGCTGGCGCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCGTCCAAGACGTCG
CAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGCGCCCCTGCCAGG
CTGCCCGGCGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTCTTGCCCACCACGTCGCGC
TTCTCGACAGTCTACGGGGCCGAGCGAGGCGGAGGCGGCGGCGGAGGAGGAGACCGGGGAGGCGGAGTCGGAGGC
GGAGGCGGCCATCGACGGATCCCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCC
ATCTACCGGCACGGCAACGACAGTCGGGCGAGCTTCCTCCGGACCGAGACGTTTGGCAGCTCCAACATGGGCGAG
GGCCCCGGACCGGCGGGCTTCATCCACGACGCCGTGGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGCTTC
CCGCTGGCGCACACCATGTGTCTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTCGACTCC
ATCGCGACGACGGACTACCCCAACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGC
GAGGCCGTTTCGACGCCCGACGTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTCCAACCC
TTCTCGTACGTGGCCGTGGCGAGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTAC
GGAGCGCGTTCTCAGATCCCCGCGGATCGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACCCCG
GCCGAGGAGGCGGCCAAGTCCAAGCCCGGCAACCGCGGCAAACGGGACAGCCAGATCATCCTCATGTCGTTCCTG
CAAAAGGTCATGTTCGACGAGCGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGC
ATCTCTCCCGACTACTACGAGATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCAC
ATGGTGTCGGCCATGGTCAAGGATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATTGCCAACAAGCGCGAC
AGCTGGGTGACGGCCATCCAGGTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTTGAGAGCGTCTTT
GGCGGCGTCACCTGCCTGCCCGGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGG
GTTCCCATCCTGGCCAACCCGGACATTGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTGCACGAGAAGAAC
CTGTACCTGCTGGGCGAGGACCGCTTCCTGACGACGCTGATGCTCCGCACCTTTCCCAAGCGGAAGCAGGTGTTT
GTGCCCCAGGCCGTGTGCAAGACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGCCGCCGCTGGATC
AACTCTACCATTCACAACCTGATGGAGCTGGTGCTGGTGCGCGATCTGTGCGGCACCTTTTGCTTCAGCATGCAG
TTTGTCATCTTTGTCGAGCTCGTCGGCACGCTGGTGTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGCCCTG
ATCCTCGGCCTCCCGGGCGTCCTCATCATCGTAACGGCCCACTCCTGGTCCTACGTCATCTGGATGATGATCTAC
CTCCTCTCCCTCCCCGTCTGGAACTTCGTGCTGCCGACGTACGCCTTTTGGAAGTTTGACGACTTCTCGTGGGGG
GATACCCGTAAGACGGCCGGCGAGAGCAGCAGCAGCAAAAAGGGCGGCGGCGGCGCAGGCGGACACGAAGACGAG
GGCGAGTTTGATAGCAGCAAGATTACCATGAAGAGGGGGGAGTGGGCTGTTTCGCCGGGGCAGTATCACGATGAG
TATCACTCTGATGTGTGA
Transcript >Ophun1|5362
ATGGACGTCCTGCCCTCGTCCACCGGCAACGACCCCATCCTCGAGAACCTCGACGGCTCCACCGAGCGATCTGGC
GGCTCCCTGCCCAACGGGAGCTTCACCGACTCTCCCCCTCGTCGCAACGACGTCAACGAGCACGAAAAGACTCTC
GAGCGTACGAGGACTCGCCAGCCCAAGCCGACCAAGATTACCAAGCCGACAAAGGGAGAGCGTCGGCCTTCCCGT
AAGAAGCAAAAGGTCGTCGAGAATCAGCTGAGACCGCCGAGCCTGTGGAACGTCTACTGCGCCATCATCACCTTT
TGGTGCCCCGACTTCGTCTTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGGAGGGAAAAGATG
GGCCTCATCAGCATCATCCTCTTCATCATGGCCATTGTCGGCTTCCTGACCTTTGGCTTCACAGCCACCGTGTGT
CGCGCGCCTCCCTTGCGCCTCCGCACCAACGAGGTGTCGGACGGATACATGATCTTCCACGGCGTCGCCTACGAT
CTCGCCAGCTCCCACCACCCTCCCGCCCGAGGCATCCCCCTGCGCCAGGACGGCATGGGCGCCAACGTCCTCTTC
GATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAATGCAAGGGCGTC
ATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTTCCCTGCACCATC
TTCAACCAGGACGGTTCGACGGCGCCCAACCTCACGATCCCCTATTACCTCGGCTATGCCTGTCACACGACGCAA
AACGCCCGCGACGCCTTTTACCGCGATCTGAGCGGAGCCGCCGACGTCTACTTTACCTGGGACGACATCAAGAAC
AGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTCAACGAGAGCCAG
GTGTCCATCCCCGACCGCTTCAAGGAGCTGCGGGACACGCGCAGCGCCGTCAACAGGGCCGTCCGCGGCCGCGAC
GTCACGCGCCTCTTCCAGTCGTCGGATGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATCAAGGTCGGCTCC
GTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTCATCCTGTCGGTG
GTGCTGGCGCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCGTCCAAGACGTCG
CAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGCGCCCCTGCCAGG
CTGCCCGGCGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTCTTGCCCACCACGTCGCGC
TTCTCGACAGTCTACGGGGCCGAGCGAGGCGGAGGCGGCGGCGGAGGAGGAGACCGGGGAGGCGGAGTCGGAGGC
GGAGGCGGCCATCGACGGATCCCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCC
ATCTACCGGCACGGCAACGACAGTCGGGCGAGCTTCCTCCGGACCGAGACGTTTGGCAGCTCCAACATGGGCGAG
GGCCCCGGACCGGCGGGCTTCATCCACGACGCCGTGGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGCTTC
CCGCTGGCGCACACCATGTGTCTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTCGACTCC
ATCGCGACGACGGACTACCCCAACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGC
GAGGCCGTTTCGACGCCCGACGTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTCCAACCC
TTCTCGTACGTGGCCGTGGCGAGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTAC
GGAGCGCGTTCTCAGATCCCCGCGGATCGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACCCCG
GCCGAGGAGGCGGCCAAGTCCAAGCCCGGCAACCGCGGCAAACGGGACAGCCAGATCATCCTCATGTCGTTCCTG
CAAAAGGTCATGTTCGACGAGCGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGC
ATCTCTCCCGACTACTACGAGATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCAC
ATGGTGTCGGCCATGGTCAAGGATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATTGCCAACAAGCGCGAC
AGCTGGGTGACGGCCATCCAGGTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTTGAGAGCGTCTTT
GGCGGCGTCACCTGCCTGCCCGGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGG
GTTCCCATCCTGGCCAACCCGGACATTGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTGCACGAGAAGAAC
CTGTACCTGCTGGGCGAGGACCGCTTCCTGACGACGCTGATGCTCCGCACCTTTCCCAAGCGGAAGCAGGTGTTT
GTGCCCCAGGCCGTGTGCAAGACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGCCGCCGCTGGATC
AACTCTACCATTCACAACCTGATGGAGCTGGTGCTGGTGCGCGATCTGTGCGGCACCTTTTGCTTCAGCATGCAG
TTTGTCATCTTTGTCGAGCTCGTCGGCACGCTGGTGTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGCCCTG
ATCCTCGGCCTCCCGGGCGTCCTCATCATCGTAACGGCCCACTCCTGGTCCTACGTCATCTGGATGATGATCTAC
CTCCTCTCCCTCCCCGTCTGGAACTTCGTGCTGCCGACGTACGCCTTTTGGAAGTTTGACGACTTCTCGTGGGGG
GATACCCGTAAGACGGCCGGCGAGAGCAGCAGCAGCAAAAAGGGCGGCGGCGGCGCAGGCGGACACGAAGACGAG
GGCGAGTTTGATAGCAGCAAGATTACCATGAAGAGGGGGGAGTGGGCTGTTTCGCCGGGGCAGTATCACGATGAG
TATCACTCTGATGTGTGA
Gene >Ophun1|5362
ATGGACGTCCTGCCCTCGTCCACCGGCAACGACCCCATCCTCGAGAACCTCGACGGCTCCACCGAGCGATCTGGC
GGCTCCCTGCCCAACGGGAGCTTCACCGACTCTCCCCCTCGTCGCAACGACGTCAACGAGCACGAAAAGACTCTC
GAGCGTACGAGGACTCGCCAGCCCAAGCCGACCAAGATTACCAAGCCGACAAAGGGAGAGCGTCGGCCTTCCCGT
AAGAAGCAAAAGGTCGTCGAGAATCAGCTGAGACCGCCGAGCCTGTGGAACGTCTACTGCGCCATCATCACCTTT
TGGTGCCCCGACTTCGTCTTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGGAGGGAAAAGATG
GGCCTCATCAGCATCATCCTCTTCATCATGGCCATTGTCGGCTTCCTGACCTTTGGCTTCACAGCCACCGTGTGT
CGCGCGCCTCCCTTGCGCCTCCGCACCAACGAGGTGTCGGACGGATACATGATCTTCCACGGCGTCGCCTACGAT
CTCGCCAGCTCCCACCACCCTCCCGCCCGAGGCATCCCCCTGCGCCAGGACGGCATGGGCGCCAACGTCCTCTTC
GATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAATGCAAGGGCGTC
ATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTTCCCTGCACCATC
TTCAACCAGGACGGTTCGACGGCGCCCAACCTCACGATCCCCTATTACCTCGGCTATGCCTGTCACACGACGCAA
AACGCCCGCGACGCCTTTTACCGCGATCTGAGCGGAGCCGCCGACGTCTACTTTACCTGGGACGACATCAAGAAC
AGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTCAACGAGAGCCAG
GTGTCCATCCCCGACCGCTTCAAGGAGCTGCGGGACACGCGCAGCGCCGTCAACAGGGCCGTCCGCGGCCGCGAC
GTCACGCGCCTCTTCCAGTCGTCGGATGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATCAAGGTCGGCTCC
GTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTCATCCTGTCGGTG
GTGCTGGCGCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCGTCCAAGACGTCG
CAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGCGCCCCTGCCAGG
CTGCCCGGCGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTCTTGCCCACCACGTCGCGC
TTCTCGACAGTCTACGGGGCCGAGCGAGGCGGAGGCGGCGGCGGAGGAGGAGACCGGGGAGGCGGAGTCGGAGGC
GGAGGCGGCCATCGACGGATCCCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCC
ATCTACCGGCACGGCAACGACAGTCGGGCGAGCTTCCTCCGGACCGAGACGTTTGGCAGCTCCAACATGGGCGAG
GGCCCCGGACCGGCGGGCTTCATCCACGACGCCGTGGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGCTTC
CCGCTGGCGCACACCATGTGTCTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTCGACTCC
ATCGCGACGACGGACTACCCCAACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGC
GAGGCCGTTTCGACGCCCGACGTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTCCAACCC
TTCTCGTACGTGGCCGTGGCGAGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTAC
GGAGCGCGTTCTCAGATCCCCGCGGATCGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACCCCG
GCCGAGGAGGCGGCCAAGTCCAAGCCCGGCAACCGCGGCAAACGGGACAGCCAGATCATCCTCATGTCGTTCCTG
CAAAAGGTCATGTTCGACGAGCGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGC
ATCTCTCCCGACTACTACGAGATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCAC
ATGGTGTCGGCCATGGTCAAGGATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATTGCCAACAAGCGCGAC
AGCTGGGTGACGGCCATCCAGGTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTTGAGAGCGTCTTT
GGCGGCGTCACCTGCCTGCCCGGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGG
GTTCCCATCCTGGCCAACCCGGACATTGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTGCACGAGAAGAAC
CTGTACCTGCTGGGCGAGGACCGCTTCCTGACGACGCTGATGCTCCGCACCTTTCCCAAGCGGAAGCAGGTGTTT
GTGCCCCAGGCCGTGTGCAAGACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGCCGCCGCTGGATC
AACTCTACCATTCACAACCTGATGGAGCTGGTGCTGGTGCGCGATCTGTGCGGCACCTTTTGCTTCAGCATGCAG
TTTGTCATCTTTGTCGAGCTCGTCGGCACGCTGGTGTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGGTGAG
TCTTCCGTCTTGTCCCCTTTTCATCTTGTCCCCCTTCTCGTTCCATCCCGTCCACGGAAGCTAACAAGAAGCCCA
GTCATAACCTCCATCGTCCACTCCCCCCCCCAAATCATCCCCCTCGTCCTCCTAGCCCTGATCCTCGGCCTCCCG
GGCGTCCTCATCATCGTAACGGCCCACTCCTGGTCCTACGTCATCTGGATGATGATCTACCTCCTCTCCCTCCCC
GTCTGGAACTTCGTGCTGCCGACGTACGCCTTTTGGAAGTTTGACGACTTCTCGTGGGGGGATACCCGTAAGACG
GCCGGCGAGAGCAGCAGCAGCAAAAAGGGCGGCGGCGGCGCAGGCGGACACGAAGACGAGGGCGAGTTTGATAGC
AGCAAGATTACCATGAAGAGGTGGGCCGAGTTTGAGAGGGAGAGGAGGAGTAGGAGTGCTTCTTATTGGGGGGGC
AGGGGGGAGTGGGCTGTTTCGCCGGGGCAGTATCACGATGAGTATCACTCTGATGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail