Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5362
Gene name
LocationContig_526:9444..12879
Strand-
Gene length (bp)3435
Transcript length (bp)3243
Coding sequence length (bp)3243
Protein length (aa) 1081

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 3.6E-265 556 1062
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.6E-13 758 1002
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.2E-06 757 926

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 1080 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 8 1062 0.0E+00
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 1 1061 0.0E+00
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1 1061 0.0E+00
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1 1066 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 1080 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 8 1062 0.0E+00
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 1 1061 0.0E+00
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1 1061 0.0E+00
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1 1066 0.0E+00
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 59 1066 0.0E+00
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 576 1064 0.0E+00
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 1 1066 0.0E+00
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 579 1047 0.0E+00
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 583 1030 1.0E-157
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 581 1062 6.0E-134
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 581 1061 6.0E-129
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 22 416 3.0E-28
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 28 437 1.0E-20
sp|P04340|NODC_RHILV N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae GN=nodC PE=3 SV=1 748 933 1.0E-15
sp|P04341|NODC_RHIME N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) GN=nodC PE=3 SV=1 747 995 4.0E-15
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 754 1067 2.0E-14
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 758 972 2.0E-14
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 708 935 3.0E-14
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 758 929 4.0E-14
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 708 935 5.0E-14
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 706 972 5.0E-14
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 741 952 9.0E-14
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 56 417 1.0E-13
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 757 958 1.0E-13
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 751 979 2.0E-13
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 758 972 2.0E-13
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 757 1011 3.0E-13
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 731 928 7.0E-13
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 757 928 7.0E-13
sp|Q61647|HYAS1_MOUSE Hyaluronan synthase 1 OS=Mus musculus GN=Has1 PE=1 SV=1 584 933 9.0E-13
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 699 929 1.0E-12
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 741 972 2.0E-12
sp|P50356|NODC_RHIGA N-acetylglucosaminyltransferase OS=Rhizobium galegae GN=nodC PE=3 SV=1 747 933 3.0E-12
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 758 926 3.0E-12
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 736 927 3.0E-12
sp|Q92839|HYAS1_HUMAN Hyaluronan synthase 1 OS=Homo sapiens GN=HAS1 PE=1 SV=2 736 933 4.0E-12
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 757 928 6.0E-12
sp|O35776|HYAS2_RAT Hyaluronan synthase 2 OS=Rattus norvegicus GN=Has2 PE=2 SV=1 736 927 7.0E-12
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 736 927 9.0E-12
sp|G5AY81|HYAS2_HETGA Hyaluronan synthase 2 OS=Heterocephalus glaber GN=Has2 PE=3 SV=1 736 927 1.0E-11
sp|Q92819|HYAS2_HUMAN Hyaluronan synthase 2 OS=Homo sapiens GN=HAS2 PE=2 SV=1 736 927 1.0E-11
sp|P70312|HYAS2_MOUSE Hyaluronan synthase 2 OS=Mus musculus GN=Has2 PE=1 SV=4 736 927 1.0E-11
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 757 928 1.0E-11
sp|P26024|NODC_BRADU N-acetylglucosaminyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodC PE=3 SV=2 747 931 2.0E-11
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 758 929 3.0E-11
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 758 929 4.0E-11
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 741 929 4.0E-11
sp|O97711|HYAS2_BOVIN Hyaluronan synthase 2 OS=Bos taurus GN=HAS2 PE=2 SV=1 736 927 4.0E-11
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 758 997 5.0E-11
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 758 929 7.0E-11
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 758 929 8.0E-11
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 758 929 2.0E-10
sp|O57427|HYAS2_XENLA Hyaluronan synthase 2 OS=Xenopus laevis GN=has2 PE=2 SV=2 736 927 4.0E-10
sp|O57424|HYAS2_CHICK Hyaluronan synthase 2 OS=Gallus gallus GN=HAS2 PE=2 SV=2 736 927 4.0E-10
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 758 987 8.0E-10
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 757 928 2.0E-09
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 72 409 3.0E-08
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 757 1011 7.0E-08
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 757 929 9.0E-08
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 91 411 8.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 127 149 22
2 388 410 22
3 964 986 22
4 993 1015 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT2_Chitin_synth_2 1.4E-268 556 1062

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4453
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1545
Ophiocordyceps australis map64 (Brazil) OphauB2|3045
Ophiocordyceps camponoti-floridani Ophcf2|04404
Ophiocordyceps camponoti-rufipedis Ophun1|5362 (this protein)
Ophiocordyceps kimflemingae Ophio5|3134
Ophiocordyceps subramaniannii Hirsu2|9242

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5362
MDVLPSSTGNDPILENLDGSTERSGGSLPNGSFTDSPPRRNDVNEHEKTLERTRTRQPKPTKITKPTKGERRPSR
KKQKVVENQLRPPSLWNVYCAIITFWCPDFVLRCFGKPTKAQRRAWREKMGLISIILFIMAIVGFLTFGFTATVC
RAPPLRLRTNEVSDGYMIFHGVAYDLASSHHPPARGIPLRQDGMGANVLFDLPEKHGGQDGSFLFQNVNGKCKGV
ITRAPGSDVPSNAADDLAWYFPCTIFNQDGSTAPNLTIPYYLGYACHTTQNARDAFYRDLSGAADVYFTWDDIKN
SSRNLIVYSGAVLDLNLLNWFNESQVSIPDRFKELRDTRSAVNRAVRGRDVTRLFQSSDDKRYAQCFEEIIKVGS
VDTETVGCIASKVVLYCALVLILSVVLARFMLALVFQWFISRNYAASKTSQSSNRRKRNQQIEAWSEDIYRAPAR
LPGDVGSTVASSNKRSSSFLPTTSRFSTVYGAERGGGGGGGGDRGGGVGGGGGHRRIPTTMTSQGASGSLLSPHS
IYRHGNDSRASFLRTETFGSSNMGEGPGPAGFIHDAVVPQPPSDWMPFGFPLAHTMCLVTAYSEGEEGIRTTLDS
IATTDYPNSHKAIVVICDGIIKGKGEAVSTPDVCLGMLRDHSTPPELVQPFSYVAVASGSKRHNMAKVYCGFYDY
GARSQIPADRQQRVPMMVIVKCGTPAEEAAKSKPGNRGKRDSQIILMSFLQKVMFDERMTELEYEMFNGLWKVTG
ISPDYYEIVLMVDADTKVFPDSLTHMVSAMVKDPEIMGLCGETKIANKRDSWVTAIQVFEYFVSHHLAKSFESVF
GGVTCLPGCFCMYRIKAPKGGQNYWVPILANPDIVEHYSENVVETLHEKNLYLLGEDRFLTTLMLRTFPKRKQVF
VPQAVCKTTVPDKFMVLLSQRRRWINSTIHNLMELVLVRDLCGTFCFSMQFVIFVELVGTLVLPAAIAFTFYVAL
ILGLPGVLIIVTAHSWSYVIWMMIYLLSLPVWNFVLPTYAFWKFDDFSWGDTRKTAGESSSSKKGGGGAGGHEDE
GEFDSSKITMKRGEWAVSPGQYHDEYHSDV*
Coding >Ophun1|5362
ATGGACGTCCTGCCCTCGTCCACCGGCAACGACCCCATCCTCGAGAACCTCGACGGCTCCACCGAGCGATCTGGC
GGCTCCCTGCCCAACGGGAGCTTCACCGACTCTCCCCCTCGTCGCAACGACGTCAACGAGCACGAAAAGACTCTC
GAGCGTACGAGGACTCGCCAGCCCAAGCCGACCAAGATTACCAAGCCGACAAAGGGAGAGCGTCGGCCTTCCCGT
AAGAAGCAAAAGGTCGTCGAGAATCAGCTGAGACCGCCGAGCCTGTGGAACGTCTACTGCGCCATCATCACCTTT
TGGTGCCCCGACTTCGTCTTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGGAGGGAAAAGATG
GGCCTCATCAGCATCATCCTCTTCATCATGGCCATTGTCGGCTTCCTGACCTTTGGCTTCACAGCCACCGTGTGT
CGCGCGCCTCCCTTGCGCCTCCGCACCAACGAGGTGTCGGACGGATACATGATCTTCCACGGCGTCGCCTACGAT
CTCGCCAGCTCCCACCACCCTCCCGCCCGAGGCATCCCCCTGCGCCAGGACGGCATGGGCGCCAACGTCCTCTTC
GATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAATGCAAGGGCGTC
ATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTTCCCTGCACCATC
TTCAACCAGGACGGTTCGACGGCGCCCAACCTCACGATCCCCTATTACCTCGGCTATGCCTGTCACACGACGCAA
AACGCCCGCGACGCCTTTTACCGCGATCTGAGCGGAGCCGCCGACGTCTACTTTACCTGGGACGACATCAAGAAC
AGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTCAACGAGAGCCAG
GTGTCCATCCCCGACCGCTTCAAGGAGCTGCGGGACACGCGCAGCGCCGTCAACAGGGCCGTCCGCGGCCGCGAC
GTCACGCGCCTCTTCCAGTCGTCGGATGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATCAAGGTCGGCTCC
GTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTCATCCTGTCGGTG
GTGCTGGCGCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCGTCCAAGACGTCG
CAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGCGCCCCTGCCAGG
CTGCCCGGCGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTCTTGCCCACCACGTCGCGC
TTCTCGACAGTCTACGGGGCCGAGCGAGGCGGAGGCGGCGGCGGAGGAGGAGACCGGGGAGGCGGAGTCGGAGGC
GGAGGCGGCCATCGACGGATCCCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCC
ATCTACCGGCACGGCAACGACAGTCGGGCGAGCTTCCTCCGGACCGAGACGTTTGGCAGCTCCAACATGGGCGAG
GGCCCCGGACCGGCGGGCTTCATCCACGACGCCGTGGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGCTTC
CCGCTGGCGCACACCATGTGTCTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTCGACTCC
ATCGCGACGACGGACTACCCCAACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGC
GAGGCCGTTTCGACGCCCGACGTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTCCAACCC
TTCTCGTACGTGGCCGTGGCGAGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTAC
GGAGCGCGTTCTCAGATCCCCGCGGATCGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACCCCG
GCCGAGGAGGCGGCCAAGTCCAAGCCCGGCAACCGCGGCAAACGGGACAGCCAGATCATCCTCATGTCGTTCCTG
CAAAAGGTCATGTTCGACGAGCGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGC
ATCTCTCCCGACTACTACGAGATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCAC
ATGGTGTCGGCCATGGTCAAGGATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATTGCCAACAAGCGCGAC
AGCTGGGTGACGGCCATCCAGGTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTTGAGAGCGTCTTT
GGCGGCGTCACCTGCCTGCCCGGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGG
GTTCCCATCCTGGCCAACCCGGACATTGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTGCACGAGAAGAAC
CTGTACCTGCTGGGCGAGGACCGCTTCCTGACGACGCTGATGCTCCGCACCTTTCCCAAGCGGAAGCAGGTGTTT
GTGCCCCAGGCCGTGTGCAAGACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGCCGCCGCTGGATC
AACTCTACCATTCACAACCTGATGGAGCTGGTGCTGGTGCGCGATCTGTGCGGCACCTTTTGCTTCAGCATGCAG
TTTGTCATCTTTGTCGAGCTCGTCGGCACGCTGGTGTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGCCCTG
ATCCTCGGCCTCCCGGGCGTCCTCATCATCGTAACGGCCCACTCCTGGTCCTACGTCATCTGGATGATGATCTAC
CTCCTCTCCCTCCCCGTCTGGAACTTCGTGCTGCCGACGTACGCCTTTTGGAAGTTTGACGACTTCTCGTGGGGG
GATACCCGTAAGACGGCCGGCGAGAGCAGCAGCAGCAAAAAGGGCGGCGGCGGCGCAGGCGGACACGAAGACGAG
GGCGAGTTTGATAGCAGCAAGATTACCATGAAGAGGGGGGAGTGGGCTGTTTCGCCGGGGCAGTATCACGATGAG
TATCACTCTGATGTGTGA
Transcript >Ophun1|5362
ATGGACGTCCTGCCCTCGTCCACCGGCAACGACCCCATCCTCGAGAACCTCGACGGCTCCACCGAGCGATCTGGC
GGCTCCCTGCCCAACGGGAGCTTCACCGACTCTCCCCCTCGTCGCAACGACGTCAACGAGCACGAAAAGACTCTC
GAGCGTACGAGGACTCGCCAGCCCAAGCCGACCAAGATTACCAAGCCGACAAAGGGAGAGCGTCGGCCTTCCCGT
AAGAAGCAAAAGGTCGTCGAGAATCAGCTGAGACCGCCGAGCCTGTGGAACGTCTACTGCGCCATCATCACCTTT
TGGTGCCCCGACTTCGTCTTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGGAGGGAAAAGATG
GGCCTCATCAGCATCATCCTCTTCATCATGGCCATTGTCGGCTTCCTGACCTTTGGCTTCACAGCCACCGTGTGT
CGCGCGCCTCCCTTGCGCCTCCGCACCAACGAGGTGTCGGACGGATACATGATCTTCCACGGCGTCGCCTACGAT
CTCGCCAGCTCCCACCACCCTCCCGCCCGAGGCATCCCCCTGCGCCAGGACGGCATGGGCGCCAACGTCCTCTTC
GATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAATGCAAGGGCGTC
ATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTTCCCTGCACCATC
TTCAACCAGGACGGTTCGACGGCGCCCAACCTCACGATCCCCTATTACCTCGGCTATGCCTGTCACACGACGCAA
AACGCCCGCGACGCCTTTTACCGCGATCTGAGCGGAGCCGCCGACGTCTACTTTACCTGGGACGACATCAAGAAC
AGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTCAACGAGAGCCAG
GTGTCCATCCCCGACCGCTTCAAGGAGCTGCGGGACACGCGCAGCGCCGTCAACAGGGCCGTCCGCGGCCGCGAC
GTCACGCGCCTCTTCCAGTCGTCGGATGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATCAAGGTCGGCTCC
GTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTCATCCTGTCGGTG
GTGCTGGCGCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCGTCCAAGACGTCG
CAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGCGCCCCTGCCAGG
CTGCCCGGCGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTCTTGCCCACCACGTCGCGC
TTCTCGACAGTCTACGGGGCCGAGCGAGGCGGAGGCGGCGGCGGAGGAGGAGACCGGGGAGGCGGAGTCGGAGGC
GGAGGCGGCCATCGACGGATCCCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCC
ATCTACCGGCACGGCAACGACAGTCGGGCGAGCTTCCTCCGGACCGAGACGTTTGGCAGCTCCAACATGGGCGAG
GGCCCCGGACCGGCGGGCTTCATCCACGACGCCGTGGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGCTTC
CCGCTGGCGCACACCATGTGTCTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTCGACTCC
ATCGCGACGACGGACTACCCCAACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGC
GAGGCCGTTTCGACGCCCGACGTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTCCAACCC
TTCTCGTACGTGGCCGTGGCGAGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTAC
GGAGCGCGTTCTCAGATCCCCGCGGATCGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACCCCG
GCCGAGGAGGCGGCCAAGTCCAAGCCCGGCAACCGCGGCAAACGGGACAGCCAGATCATCCTCATGTCGTTCCTG
CAAAAGGTCATGTTCGACGAGCGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGC
ATCTCTCCCGACTACTACGAGATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCAC
ATGGTGTCGGCCATGGTCAAGGATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATTGCCAACAAGCGCGAC
AGCTGGGTGACGGCCATCCAGGTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTTGAGAGCGTCTTT
GGCGGCGTCACCTGCCTGCCCGGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGG
GTTCCCATCCTGGCCAACCCGGACATTGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTGCACGAGAAGAAC
CTGTACCTGCTGGGCGAGGACCGCTTCCTGACGACGCTGATGCTCCGCACCTTTCCCAAGCGGAAGCAGGTGTTT
GTGCCCCAGGCCGTGTGCAAGACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGCCGCCGCTGGATC
AACTCTACCATTCACAACCTGATGGAGCTGGTGCTGGTGCGCGATCTGTGCGGCACCTTTTGCTTCAGCATGCAG
TTTGTCATCTTTGTCGAGCTCGTCGGCACGCTGGTGTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGCCCTG
ATCCTCGGCCTCCCGGGCGTCCTCATCATCGTAACGGCCCACTCCTGGTCCTACGTCATCTGGATGATGATCTAC
CTCCTCTCCCTCCCCGTCTGGAACTTCGTGCTGCCGACGTACGCCTTTTGGAAGTTTGACGACTTCTCGTGGGGG
GATACCCGTAAGACGGCCGGCGAGAGCAGCAGCAGCAAAAAGGGCGGCGGCGGCGCAGGCGGACACGAAGACGAG
GGCGAGTTTGATAGCAGCAAGATTACCATGAAGAGGGGGGAGTGGGCTGTTTCGCCGGGGCAGTATCACGATGAG
TATCACTCTGATGTGTGA
Gene >Ophun1|5362
ATGGACGTCCTGCCCTCGTCCACCGGCAACGACCCCATCCTCGAGAACCTCGACGGCTCCACCGAGCGATCTGGC
GGCTCCCTGCCCAACGGGAGCTTCACCGACTCTCCCCCTCGTCGCAACGACGTCAACGAGCACGAAAAGACTCTC
GAGCGTACGAGGACTCGCCAGCCCAAGCCGACCAAGATTACCAAGCCGACAAAGGGAGAGCGTCGGCCTTCCCGT
AAGAAGCAAAAGGTCGTCGAGAATCAGCTGAGACCGCCGAGCCTGTGGAACGTCTACTGCGCCATCATCACCTTT
TGGTGCCCCGACTTCGTCTTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGGAGGGAAAAGATG
GGCCTCATCAGCATCATCCTCTTCATCATGGCCATTGTCGGCTTCCTGACCTTTGGCTTCACAGCCACCGTGTGT
CGCGCGCCTCCCTTGCGCCTCCGCACCAACGAGGTGTCGGACGGATACATGATCTTCCACGGCGTCGCCTACGAT
CTCGCCAGCTCCCACCACCCTCCCGCCCGAGGCATCCCCCTGCGCCAGGACGGCATGGGCGCCAACGTCCTCTTC
GATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAATGCAAGGGCGTC
ATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTTCCCTGCACCATC
TTCAACCAGGACGGTTCGACGGCGCCCAACCTCACGATCCCCTATTACCTCGGCTATGCCTGTCACACGACGCAA
AACGCCCGCGACGCCTTTTACCGCGATCTGAGCGGAGCCGCCGACGTCTACTTTACCTGGGACGACATCAAGAAC
AGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTCAACGAGAGCCAG
GTGTCCATCCCCGACCGCTTCAAGGAGCTGCGGGACACGCGCAGCGCCGTCAACAGGGCCGTCCGCGGCCGCGAC
GTCACGCGCCTCTTCCAGTCGTCGGATGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATCAAGGTCGGCTCC
GTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTCATCCTGTCGGTG
GTGCTGGCGCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCGTCCAAGACGTCG
CAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGCGCCCCTGCCAGG
CTGCCCGGCGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTCTTGCCCACCACGTCGCGC
TTCTCGACAGTCTACGGGGCCGAGCGAGGCGGAGGCGGCGGCGGAGGAGGAGACCGGGGAGGCGGAGTCGGAGGC
GGAGGCGGCCATCGACGGATCCCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCC
ATCTACCGGCACGGCAACGACAGTCGGGCGAGCTTCCTCCGGACCGAGACGTTTGGCAGCTCCAACATGGGCGAG
GGCCCCGGACCGGCGGGCTTCATCCACGACGCCGTGGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGCTTC
CCGCTGGCGCACACCATGTGTCTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTCGACTCC
ATCGCGACGACGGACTACCCCAACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGC
GAGGCCGTTTCGACGCCCGACGTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTCCAACCC
TTCTCGTACGTGGCCGTGGCGAGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTAC
GGAGCGCGTTCTCAGATCCCCGCGGATCGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACCCCG
GCCGAGGAGGCGGCCAAGTCCAAGCCCGGCAACCGCGGCAAACGGGACAGCCAGATCATCCTCATGTCGTTCCTG
CAAAAGGTCATGTTCGACGAGCGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGC
ATCTCTCCCGACTACTACGAGATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCAC
ATGGTGTCGGCCATGGTCAAGGATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATTGCCAACAAGCGCGAC
AGCTGGGTGACGGCCATCCAGGTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTTGAGAGCGTCTTT
GGCGGCGTCACCTGCCTGCCCGGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGG
GTTCCCATCCTGGCCAACCCGGACATTGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTGCACGAGAAGAAC
CTGTACCTGCTGGGCGAGGACCGCTTCCTGACGACGCTGATGCTCCGCACCTTTCCCAAGCGGAAGCAGGTGTTT
GTGCCCCAGGCCGTGTGCAAGACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGCCGCCGCTGGATC
AACTCTACCATTCACAACCTGATGGAGCTGGTGCTGGTGCGCGATCTGTGCGGCACCTTTTGCTTCAGCATGCAG
TTTGTCATCTTTGTCGAGCTCGTCGGCACGCTGGTGTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGGTGAG
TCTTCCGTCTTGTCCCCTTTTCATCTTGTCCCCCTTCTCGTTCCATCCCGTCCACGGAAGCTAACAAGAAGCCCA
GTCATAACCTCCATCGTCCACTCCCCCCCCCAAATCATCCCCCTCGTCCTCCTAGCCCTGATCCTCGGCCTCCCG
GGCGTCCTCATCATCGTAACGGCCCACTCCTGGTCCTACGTCATCTGGATGATGATCTACCTCCTCTCCCTCCCC
GTCTGGAACTTCGTGCTGCCGACGTACGCCTTTTGGAAGTTTGACGACTTCTCGTGGGGGGATACCCGTAAGACG
GCCGGCGAGAGCAGCAGCAGCAAAAAGGGCGGCGGCGGCGCAGGCGGACACGAAGACGAGGGCGAGTTTGATAGC
AGCAAGATTACCATGAAGAGGTGGGCCGAGTTTGAGAGGGAGAGGAGGAGTAGGAGTGCTTCTTATTGGGGGGGC
AGGGGGGAGTGGGCTGTTTCGCCGGGGCAGTATCACGATGAGTATCACTCTGATGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail