Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5360
Gene name
LocationContig_526:4157..4867
Strand-
Gene length (bp)710
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07047 OPA3 Optic atrophy 3 protein (OPA3) 6.5E-49 7 178

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4451
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2900
Ophiocordyceps australis map64 (Brazil) OphauB2|3043
Ophiocordyceps camponoti-floridani Ophcf2|04406
Ophiocordyceps camponoti-rufipedis Ophun1|5360 (this protein)
Ophiocordyceps kimflemingae Ophio5|3136
Ophiocordyceps subramaniannii Hirsu2|9240

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5360
MVPLPLFKLAALFVRHVSKYGANRIKAQAHDHPRFRAFAARYGQSMHQLNMKLSVAVLRDPEAERRAKEKADAPT
AKTEEQHRRDEAAKEKAKSCASSKSRPVFAFQNVWRRKFRPLPEAKAVDLFADVVGDAFILAVACGLIIYEYWKS
SQKPDQNKERIDDLDRRCRELQKREDDLADAEEQHRKRLVVLEEALRSLQDPKTKQPLPSAVPAP*
Coding >Ophun1|5360
ATGGTGCCGCTGCCGCTCTTCAAGCTCGCCGCCCTCTTTGTGCGCCACGTCTCTAAATACGGCGCGAATCGCATC
AAAGCACAGGCGCACGATCACCCTCGGTTTCGCGCCTTTGCCGCCCGGTATGGACAATCAATGCACCAGCTCAAC
ATGAAGCTGTCCGTCGCCGTCCTTCGCGATCCCGAAGCCGAGCGACGAGCCAAGGAAAAGGCAGACGCTCCCACG
GCCAAGACGGAGGAGCAGCATCGACGCGACGAGGCAGCCAAGGAAAAAGCCAAATCGTGTGCGTCGTCGAAGAGC
CGACCCGTCTTCGCCTTTCAGAACGTGTGGAGGCGCAAGTTCCGTCCGTTGCCCGAGGCCAAGGCCGTCGACCTG
TTCGCGGATGTCGTCGGAGATGCTTTCATCCTTGCTGTTGCCTGCGGCCTTATTATATATGAGTACTGGAAGTCG
TCGCAGAAGCCTGACCAGAACAAGGAACGCATTGACGACCTTGACCGGCGCTGTCGCGAGCTGCAGAAGAGGGAA
GACGACTTGGCTGATGCCGAGGAGCAGCACAGGAAGAGGCTGGTGGTCCTGGAGGAGGCGCTGCGGTCACTGCAG
GACCCGAAGACGAAGCAGCCGTTGCCATCGGCTGTGCCGGCGCCGTGA
Transcript >Ophun1|5360
ATGGTGCCGCTGCCGCTCTTCAAGCTCGCCGCCCTCTTTGTGCGCCACGTCTCTAAATACGGCGCGAATCGCATC
AAAGCACAGGCGCACGATCACCCTCGGTTTCGCGCCTTTGCCGCCCGGTATGGACAATCAATGCACCAGCTCAAC
ATGAAGCTGTCCGTCGCCGTCCTTCGCGATCCCGAAGCCGAGCGACGAGCCAAGGAAAAGGCAGACGCTCCCACG
GCCAAGACGGAGGAGCAGCATCGACGCGACGAGGCAGCCAAGGAAAAAGCCAAATCGTGTGCGTCGTCGAAGAGC
CGACCCGTCTTCGCCTTTCAGAACGTGTGGAGGCGCAAGTTCCGTCCGTTGCCCGAGGCCAAGGCCGTCGACCTG
TTCGCGGATGTCGTCGGAGATGCTTTCATCCTTGCTGTTGCCTGCGGCCTTATTATATATGAGTACTGGAAGTCG
TCGCAGAAGCCTGACCAGAACAAGGAACGCATTGACGACCTTGACCGGCGCTGTCGCGAGCTGCAGAAGAGGGAA
GACGACTTGGCTGATGCCGAGGAGCAGCACAGGAAGAGGCTGGTGGTCCTGGAGGAGGCGCTGCGGTCACTGCAG
GACCCGAAGACGAAGCAGCCGTTGCCATCGGCTGTGCCGGCGCCGTGA
Gene >Ophun1|5360
ATGGTGCCGCTGCCGCTCTTCAAGCTCGCCGCCCTCTTTGTGCGCCACGTCTCTAAATACGGCGCGGTAAGGGGC
CAGACCCGTACGACCATTTCAAGACCGCTGCTGATAGACCTTGTCGCTGCCAGAATCGCATCAAAGCACAGGCGC
ACGATCACCCTCGGTTTCGCGCCTTTGCCGCCCGGTATGGACAATCAATGCACCAGCTCAACATGAAGCTGTCCG
TCGCCGTCCTTCGCGATCCCGAAGCCGAGCGACGAGCCAAGGAAAAGGCAGACGCTCCCACGGCCAAGACGGAGG
AGCAGCATCGACGCGACGAGGCAGCCAAGGAAAAAGCCAAATCGTGTGCGTCGTCGAAGAGCCGACCCGTCTTCG
CCTTTCAGAACGTGTGGAGGCGCAAGTTCCGTCCGTTGCCCGAGGCCAAGGCCGTCGACCTGTTCGCGGATGTCG
TCGGAGATGCTTTCATCCTTGCTGTTGCCTGCGGCCTTATTATATATGAGTACTGGAAGTCGTCGCAGAAGCCTG
ACCAGAACAAGGAACGCATTGACGACCTTGACCGGCGCTGTCGCGAGCTGCAGAAGAGGGAAGACGACTTGGCTG
ATGCCGAGGAGCAGCACAGGAAGAGGCTGGTGGTCCTGGAGGAGGCGCTGCGGTCACTGCAGGACCCGAAGACGA
AGCAGCCGTTGCCATCGGCTGTGCCGGCGCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail