Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5357
Gene name
LocationContig_525:6352..6780
Strand+
Gene length (bp)428
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09724 Dcc1 Sister chromatid cohesion protein Dcc1 8.9E-08 16 78

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0007064 mitotic sister chromatid cohesion Yes
GO:0031390 Ctf18 RFC-like complex Yes
GO:0022402 cell cycle process No
GO:0016043 cellular component organization No
GO:0006996 organelle organization No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:1903047 mitotic cell cycle process No
GO:0051276 chromosome organization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0007062 sister chromatid cohesion No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5916
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|53
Ophiocordyceps australis map64 (Brazil) OphauB2|5916
Ophiocordyceps camponoti-floridani Ophcf2|03080
Ophiocordyceps camponoti-rufipedis Ophun1|5357 (this protein)
Ophiocordyceps kimflemingae Ophio5|1534

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5357
MPTSVPLIHHPQSISYRLFELPPEVETLLQSPTAPVLTLDDSPEASTAVLRTPNGHYAIRQKNTSNSLLILSPSS
APQGLAVVATLHETFGMQSVPTTPAGLGRLKHNGSGGKWHERFGRNR*
Coding >Ophun1|5357
ATGCCCACCTCGGTTCCCCTGATTCACCACCCCCAGTCCATATCTTACCGCCTCTTCGAGCTTCCCCCCGAAGTC
GAAACGCTGCTGCAATCGCCTACAGCCCCCGTCCTCACCCTCGACGACAGCCCCGAAGCCTCCACCGCCGTCCTC
CGCACTCCAAACGGCCACTACGCCATCCGCCAGAAGAACACGTCAAACTCCCTCCTCATCCTCTCTCCCTCATCC
GCCCCTCAGGGCCTCGCCGTCGTCGCCACTCTCCACGAGACCTTCGGCATGCAATCCGTGCCCACCACCCCCGCC
GGCCTCGGCAGGCTCAAGCATAATGGCAGTGGGGGCAAATGGCATGAGAGGTTTGGGAGGAACAGGTAG
Transcript >Ophun1|5357
ATGCCCACCTCGGTTCCCCTGATTCACCACCCCCAGTCCATATCTTACCGCCTCTTCGAGCTTCCCCCCGAAGTC
GAAACGCTGCTGCAATCGCCTACAGCCCCCGTCCTCACCCTCGACGACAGCCCCGAAGCCTCCACCGCCGTCCTC
CGCACTCCAAACGGCCACTACGCCATCCGCCAGAAGAACACGTCAAACTCCCTCCTCATCCTCTCTCCCTCATCC
GCCCCTCAGGGCCTCGCCGTCGTCGCCACTCTCCACGAGACCTTCGGCATGCAATCCGTGCCCACCACCCCCGCC
GGCCTCGGCAGGCTCAAGCATAATGGCAGTGGGGGCAAATGGCATGAGAGGTTTGGGAGGAACAGGTAG
Gene >Ophun1|5357
ATGCCCACCTCGGTTCCCCTGATTCACCACCCCCAGTCCATATCTTACCGCCTCTTCGAGCTTCCCCCCGAAGTC
GAAACGCTGCTGCAATCGCCTACAGCCCCCGTGTTTGTCCCTCCAGCTGCCATCTTCCAGTCCCCACGATGCCGA
GAATAACCCTCTACAGCCTCACCCTCGACGACAGCCCCGAAGCCTCCACCGCCGTCCTCCGCACTCCAAACGGCC
ACTACGCCATCCGCCAGAAGAACACGTCAAACTCCCTCCTCATCCTCTCTCCCTCATCCGCCCCTCAGGGCCTCG
CCGTCGTCGCCACTCTCCACGAGACCTTCGGCATGCAATCCGTGCCCACCACCCCCGCCGGCCTCGGCAGGCTCA
AGCATAATGGCAGTGGGGGCAAATGGCATGAGAGGTTTGGGAGGAACAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail