Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5354
Gene name
LocationContig_524:8554..13124
Strand+
Gene length (bp)4570
Transcript length (bp)4407
Coding sequence length (bp)4407
Protein length (aa) 1469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 4.2E-16 452 549
PF00168 C2 C2 domain 2.9E-13 594 699
PF00168 C2 C2 domain 1.5E-17 734 819
PF00168 C2 C2 domain 3.8E-22 1079 1181
PF00168 C2 C2 domain 3.0E-03 1324 1410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 164 1256 0.0E+00
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 122 1254 0.0E+00
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 156 1251 2.0E-177
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 103 1256 1.0E-163
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 142 1428 4.0E-137
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 164 1256 0.0E+00
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 122 1254 0.0E+00
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 156 1251 2.0E-177
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 103 1256 1.0E-163
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 142 1428 4.0E-137
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 231 713 3.0E-32
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 232 715 6.0E-28
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 224 714 1.0E-27
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 224 714 1.0E-27
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 232 718 2.0E-27
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 176 790 3.0E-27
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 176 790 5.0E-27
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 176 790 1.0E-26
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 176 790 3.0E-26
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 213 687 2.0E-15
sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 183 687 7.0E-15
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 233 702 1.0E-14
sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 175 542 2.0E-14
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1078 1196 8.0E-14
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1051 1219 1.0E-12
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 159 549 2.0E-12
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 1080 1219 1.0E-11
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 1080 1219 2.0E-11
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1079 1169 8.0E-11
sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 1081 1170 8.0E-11
sp|Q86SS6|SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens GN=SYT9 PE=2 SV=1 603 816 1.0E-10
sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 1081 1170 1.0E-10
sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 1075 1268 2.0E-10
sp|Q9R0N9|SYT9_MOUSE Synaptotagmin-9 OS=Mus musculus GN=Syt9 PE=1 SV=2 603 816 2.0E-10
sp|Q925C0|SYT9_RAT Synaptotagmin-9 OS=Rattus norvegicus GN=Syt9 PE=1 SV=1 603 816 2.0E-10
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 1079 1192 3.0E-10
sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 1075 1268 3.0E-10
sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 1079 1192 4.0E-10
sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 1079 1192 5.0E-10
sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 1079 1182 1.0E-09
sp|Q9BQG1|SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens GN=SYT3 PE=2 SV=1 1080 1175 1.0E-09
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 1079 1192 2.0E-09
sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 1080 1175 2.0E-09
sp|O35681|SYT3_MOUSE Synaptotagmin-3 OS=Mus musculus GN=Syt3 PE=1 SV=2 1081 1175 2.0E-09
sp|Q86KB1|ADCB_DICDI Arrestin domain-containing protein B OS=Dictyostelium discoideum GN=adcB PE=3 SV=1 1081 1198 3.0E-09
sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 233 687 5.0E-09
sp|P46097|SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus GN=Syt2 PE=1 SV=1 1080 1183 5.0E-09
sp|Q8N9I0|SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens GN=SYT2 PE=1 SV=2 1080 1183 1.0E-08
sp|P29101|SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus GN=Syt2 PE=1 SV=1 1080 1183 1.0E-08
sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 1079 1170 1.0E-08
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 1063 1192 2.0E-08
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 452 712 3.0E-08
sp|P24507|SY63_DIPOM Synaptotagmin-C OS=Diplobatis ommata GN=P65-C PE=2 SV=1 1080 1164 3.0E-08
sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 591 816 4.0E-08
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 1069 1196 5.0E-08
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 1078 1196 5.0E-08
sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens GN=ESYT3 PE=1 SV=1 1063 1192 5.0E-08
sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 233 524 7.0E-08
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 1072 1169 8.0E-08
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1061 1170 1.0E-07
sp|Q9BQG1|SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens GN=SYT3 PE=2 SV=1 591 816 1.0E-07
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 706 914 2.0E-07
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 1079 1201 2.0E-07
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 1047 1164 2.0E-07
sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 1080 1167 2.0E-07
sp|P24506|SY62_DIPOM Synaptotagmin-B OS=Diplobatis ommata GN=P65-B PE=1 SV=1 1080 1176 2.0E-07
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 1072 1167 2.0E-07
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 1072 1167 2.0E-07
sp|O35681|SYT3_MOUSE Synaptotagmin-3 OS=Mus musculus GN=Syt3 PE=1 SV=2 596 816 3.0E-07
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 1072 1169 3.0E-07
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 733 877 3.0E-07
sp|A0A075F932|SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoid GN=SYT1 PE=2 SV=1 1080 1160 3.0E-07
sp|Q14184|DOC2B_HUMAN Double C2-like domain-containing protein beta OS=Homo sapiens GN=DOC2B PE=1 SV=1 1023 1168 3.0E-07
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 733 895 3.0E-07
sp|P47191|SYT1_CHICK Synaptotagmin-1 OS=Gallus gallus GN=SYT1 PE=2 SV=1 1079 1160 3.0E-07
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 1078 1196 4.0E-07
sp|P24507|SY63_DIPOM Synaptotagmin-C OS=Diplobatis ommata GN=P65-C PE=2 SV=1 597 816 5.0E-07
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 733 816 5.0E-07
sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD11 OS=Arabidopsis thaliana GN=AGD11 PE=2 SV=1 1078 1169 6.0E-07
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 1078 1171 7.0E-07
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1081 1169 9.0E-07
sp|P24505|SY61_DIPOM Synaptotagmin-A OS=Diplobatis ommata GN=P65-A PE=2 SV=1 1080 1170 9.0E-07
sp|O94812|BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens GN=BAIAP3 PE=1 SV=2 1080 1169 9.0E-07
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 730 812 1.0E-06
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 452 712 1.0E-06
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 1079 1160 1.0E-06
sp|Q80TT2|BAIP3_MOUSE BAI1-associated protein 3 OS=Mus musculus GN=Baiap3 PE=1 SV=3 1080 1169 1.0E-06
sp|P21521|SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster GN=Syt1 PE=1 SV=3 1077 1176 1.0E-06
sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 1079 1160 1.0E-06
sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 1079 1160 1.0E-06
sp|P46096|SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1 1079 1160 1.0E-06
sp|P21707|SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3 1079 1160 1.0E-06
sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 1079 1160 1.0E-06
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 730 845 2.0E-06
sp|Q2WGJ9|FR1L6_HUMAN Fer-1-like protein 6 OS=Homo sapiens GN=FER1L6 PE=2 SV=2 1080 1181 2.0E-06
sp|P41885|RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans GN=rbf-1 PE=1 SV=2 596 819 2.0E-06
sp|Q9PU36|PCLO_CHICK Protein piccolo (Fragment) OS=Gallus gallus GN=PCLO PE=2 SV=1 1076 1188 2.0E-06
sp|Q6XYQ8|SYT10_HUMAN Synaptotagmin-10 OS=Homo sapiens GN=SYT10 PE=2 SV=1 603 813 2.0E-06
sp|Q5RCK6|SYT10_PONAB Synaptotagmin-10 OS=Pongo abelii GN=SYT10 PE=2 SV=1 603 813 2.0E-06
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 1081 1196 3.0E-06
sp|Q9R0N4|SYT10_MOUSE Synaptotagmin-10 OS=Mus musculus GN=Syt10 PE=1 SV=1 603 813 3.0E-06
sp|O08625|SYT10_RAT Synaptotagmin-10 OS=Rattus norvegicus GN=Syt10 PE=2 SV=2 603 813 3.0E-06
sp|P70610|DOC2B_RAT Double C2-like domain-containing protein beta OS=Rattus norvegicus GN=Doc2b PE=1 SV=2 1023 1168 3.0E-06
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 1081 1196 4.0E-06
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 1081 1196 4.0E-06
sp|P41885|RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans GN=rbf-1 PE=1 SV=2 1018 1168 4.0E-06
sp|P34693|SYT1_CAEEL Synaptotagmin-1 OS=Caenorhabditis elegans GN=snt-1 PE=2 SV=1 1079 1170 4.0E-06
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 1080 1169 4.0E-06
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 1080 1169 4.0E-06
sp|P70169|DOC2B_MOUSE Double C2-like domain-containing protein beta OS=Mus musculus GN=Doc2b PE=1 SV=2 1023 1168 4.0E-06
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 1080 1169 4.0E-06
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 1042 1147 5.0E-06
sp|Q9Y6V0|PCLO_HUMAN Protein piccolo OS=Homo sapiens GN=PCLO PE=1 SV=4 1077 1188 6.0E-06
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 1079 1196 8.0E-06
sp|Q9JKS6|PCLO_RAT Protein piccolo OS=Rattus norvegicus GN=Pclo PE=1 SV=1 1077 1188 8.0E-06
sp|Q54E35|GACEE_DICDI Rho GTPase-activating protein gacEE OS=Dictyostelium discoideum GN=gacEE PE=3 SV=2 1079 1207 8.0E-06
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 734 830 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 173 195 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5354
MSALEETELKAQGVIEAAENPQSLISADEAEREIVELSKNAGVTAFNFDPDASVAQKRAQARAAIPPELQQSRRE
KGAAIITDQDDGAGPDEDLPEPSKAGVLDVATTGDGKQIVAGADPLAAEEPFSRTGWSPQMGWPDSSALEGDSLL
DHGTWVEGKLPDTLYGDWYHNAAIIVFACISSWLIAVLGGGLAWVTIIMAVCATYYRTSLRRVRRNFRDDVTREL
AMKKLDTDNESLEWINSFLVKFWPIYQPVLAQTIINSVDQVLSSATPAFLDSLKLKTFTLGSKPPRMEHVKTYPK
TEDDIVMMDWKFSFTPNDTADMTARQIKNKINPKVVLEIRIGKAMISKGFDVIVEDMAFSGIMRLRIKLQIPFPH
VDRVEMCFLERPTIDYVCKPLGGDNLGFDINFIPGLETFILEQIHGNLSPMMYAPNVFPIEVAKMLAGTPVDQAV
GVLALTLHGAQGLKNTDNFGGTIDPYASISFSRRQELARTKTIDDNPNPRWNETHYLIVTSFSDTVDIQVFDKNE
FRKSKELGVASFYLEDLLDDPVYENERLEVISNGKARGIVSCDLRFFPVLEAEKTPDGKMEPPPPSNQGILRFTV
EQAKDLDGTKSLYGLLNPYAVMFINGKTMHQTKKLKRTNNPIWDNGSKEILITDRKKAKLGVTIKDDRDLAADQE
LGKYQIRLDEMLECMEQGKEWYQLSGAQTGRVKMMAQWRPVAISGVAGTGGYLTPIGVMRLHFVRATDLRNLEAF
GKSDPYVRVMLSGIDKARTVTFKNDLNPEWDEVLYVPIHSDRDRLTLEVMDFEKVGKDRSLGALELFASDYVREA
ENGEFLVHDDKHVREEGLRMHGKGIAKGTLTYTASFFPCLNVADPEDEEKEEKEKEQKEKEHQAAEKGDTETAKK
DGVKAAATTTDEKEPLRRSMSTKGGRSSQEDDGPPKIRLTPEELLKHESGLLIFSLLEAELPDNNSRLEVWVDDM
AYPSYVSSAAPSRTHKFDEIGDCVIRELDVSRLILKARKKGDDKDETVAQLAGNTMETLKQCLNNPTKLKLKTED
GKDGWVKVSLKYIPIKMQLDPSESINNMGKLRVDILDGTDLPSADRNGKSDPYCRFELNGHEVYKTKIIKKTLSP
VWNECFEVSVPSRTAADFVVNVYDYDFADKPDFLGAAVIKLAALEPFKPLETHYPLDGKSGSVRIRMLFRPDYVT
RSVHGTSTFSGTFGPGRIVTGVAGAPIKGGVAVAGAVGHGVGRGASRLKRGIFGKKDVDEVNGPTMAIDGPDGEG
TSMLTRLPTVTHQEPEPMTSRHNSFSRGRTKSLTASSMHSMSPGGASGRATFTVVKASGFPAGTDLYVVVSQMAP
KEKTVGKTKHFKSSSAEWTFDETFSARCSSDAQFRIEAKVDRFIGSDEALGEHVYFVDETGTGTAKELPVGSGSV
IIKSSFQPSDEAAESPRAHNLRRSFLGKRGEGRSSREATPNAP*
Coding >Ophun1|5354
ATGTCTGCCTTGGAGGAGACGGAGCTCAAGGCTCAGGGCGTCATCGAGGCGGCCGAAAATCCGCAGAGCCTGATA
TCGGCTGATGAGGCCGAGAGGGAAATCGTTGAGCTGTCCAAGAATGCTGGTGTCACGGCCTTCAATTTCGACCCG
GACGCCAGCGTGGCGCAGAAGCGCGCGCAAGCTCGGGCTGCTATCCCTCCGGAGCTTCAGCAGAGCCGGCGCGAG
AAAGGAGCGGCCATCATCACCGATCAGGACGATGGTGCAGGCCCGGATGAGGACCTGCCCGAGCCGAGCAAGGCT
GGCGTTCTTGATGTAGCCACGACCGGAGACGGCAAGCAGATCGTGGCTGGCGCCGACCCGTTGGCAGCCGAGGAG
CCCTTCTCCCGTACCGGATGGTCGCCTCAGATGGGCTGGCCCGATTCCAGCGCCCTGGAGGGAGATAGTCTACTG
GATCACGGCACCTGGGTCGAGGGCAAGCTCCCGGACACTCTCTACGGTGACTGGTATCACAATGCTGCCATCATC
GTCTTCGCCTGTATCTCGTCGTGGCTCATTGCCGTCCTCGGCGGAGGTCTGGCCTGGGTCACCATCATCATGGCC
GTCTGCGCCACCTACTACCGAACCTCGCTCCGGCGCGTGCGTCGCAACTTCCGGGACGACGTCACGAGAGAGCTG
GCCATGAAGAAGCTCGATACGGACAACGAGTCCCTCGAGTGGATCAACTCGTTTCTCGTCAAGTTTTGGCCCATA
TACCAGCCCGTTCTAGCCCAGACCATCATCAACTCGGTCGATCAGGTCCTCAGTTCCGCTACGCCCGCCTTCCTC
GACAGCTTGAAGCTCAAGACGTTTACGCTCGGGTCTAAACCACCGCGCATGGAGCACGTCAAGACGTACCCCAAG
ACCGAGGACGATATTGTCATGATGGACTGGAAGTTCAGCTTCACGCCAAACGACACGGCCGACATGACGGCTCGT
CAGATCAAGAACAAGATCAACCCGAAGGTGGTGCTCGAGATCCGTATCGGCAAGGCCATGATCAGCAAGGGCTTC
GACGTCATCGTCGAGGACATGGCCTTTTCCGGCATCATGCGGCTGAGGATCAAATTGCAGATACCCTTCCCCCAC
GTTGACCGTGTAGAGATGTGCTTCCTCGAGCGTCCGACCATCGACTACGTCTGTAAGCCCCTGGGTGGCGACAAT
TTGGGCTTCGACATCAACTTCATCCCGGGCCTCGAGACCTTTATCCTCGAGCAGATCCACGGCAACCTCTCGCCC
ATGATGTACGCCCCCAACGTCTTCCCCATCGAGGTGGCCAAGATGCTGGCCGGCACGCCCGTCGACCAGGCCGTC
GGCGTGCTCGCCCTGACGCTCCACGGCGCCCAGGGCCTCAAGAATACGGACAACTTTGGTGGCACCATCGACCCG
TATGCCTCCATCAGCTTCAGTCGACGCCAGGAGCTCGCGAGGACCAAGACGATCGACGACAACCCCAATCCGAGG
TGGAACGAGACGCACTACCTCATCGTTACGTCCTTTAGTGACACGGTCGACATTCAAGTCTTTGACAAGAATGAA
TTCCGCAAGTCCAAGGAGCTGGGAGTGGCCTCGTTCTACCTCGAGGACCTCCTCGATGACCCTGTGTATGAGAAC
GAGCGTCTTGAAGTCATCTCCAACGGCAAGGCGCGCGGCATCGTCTCGTGTGACCTGCGCTTCTTCCCCGTCCTC
GAGGCGGAGAAGACGCCCGACGGCAAGATGGAGCCGCCACCGCCGTCGAACCAGGGAATCTTACGCTTCACTGTC
GAGCAGGCCAAGGATCTTGATGGCACCAAGAGTCTCTACGGCCTGCTGAACCCTTACGCCGTCATGTTCATCAAC
GGCAAGACGATGCATCAGACCAAGAAGCTGAAGCGCACCAACAACCCCATCTGGGACAACGGCTCCAAGGAGATA
CTCATCACGGACCGCAAAAAGGCCAAGCTCGGCGTCACCATCAAGGACGATCGCGACCTGGCGGCCGACCAAGAG
CTCGGCAAGTACCAGATCAGGCTGGACGAGATGCTCGAATGCATGGAGCAGGGCAAGGAGTGGTACCAGCTGTCT
GGCGCCCAGACGGGCCGCGTCAAGATGATGGCCCAGTGGAGGCCCGTGGCCATCTCGGGCGTCGCCGGCACCGGA
GGTTATCTCACGCCCATCGGAGTCATGCGGCTGCACTTCGTCCGGGCCACTGATCTGCGTAATCTCGAGGCCTTT
GGCAAGTCGGATCCGTATGTCCGCGTGATGCTCTCGGGCATCGACAAGGCACGGACCGTGACGTTCAAGAACGAC
CTCAACCCGGAGTGGGACGAGGTCCTTTACGTGCCCATCCACTCGGACCGCGACAGGCTCACTCTCGAGGTGATG
GATTTCGAAAAGGTGGGCAAGGACCGGAGCCTGGGCGCCCTCGAGCTGTTCGCCTCCGACTACGTCCGCGAGGCC
GAAAATGGCGAGTTCCTGGTCCACGACGACAAGCATGTCCGTGAAGAGGGCCTGCGTATGCACGGCAAGGGCATC
GCCAAGGGGACTCTGACTTACACGGCCTCTTTCTTCCCCTGCCTCAACGTCGCGGATCCCGAGGACGAGGAGAAG
GAGGAGAAGGAGAAGGAGCAGAAGGAAAAGGAGCACCAGGCGGCTGAAAAGGGAGACACAGAGACTGCCAAAAAG
GACGGCGTAAAGGCGGCGGCGACGACCACGGACGAAAAGGAGCCCTTGCGGCGATCAATGTCGACAAAGGGGGGA
CGCTCGTCACAGGAAGACGATGGACCACCCAAGATCCGGCTCACGCCCGAGGAGCTCCTCAAGCACGAGAGCGGA
CTGCTCATCTTTTCCCTGCTGGAGGCGGAGCTTCCGGACAACAACAGCCGGCTGGAGGTCTGGGTCGACGACATG
GCCTACCCTTCGTACGTGTCTTCGGCGGCACCGTCGCGGACTCACAAGTTTGACGAGATTGGCGACTGTGTGATC
CGCGAGCTGGATGTGTCGCGGCTTATTCTCAAGGCGCGCAAGAAGGGAGACGACAAGGACGAGACGGTGGCCCAG
CTGGCAGGCAACACGATGGAGACGCTCAAGCAGTGTCTGAACAACCCGACGAAGCTCAAGCTCAAGACCGAGGAC
GGCAAGGACGGTTGGGTCAAGGTCAGCCTCAAGTACATACCCATCAAGATGCAGCTGGACCCGAGCGAGAGCATC
AACAACATGGGCAAGCTCCGGGTCGACATCCTGGACGGCACGGACCTGCCTTCGGCGGACCGCAACGGGAAGAGT
GACCCCTACTGCCGGTTCGAGCTCAACGGGCACGAGGTGTACAAGACCAAGATCATCAAGAAGACGCTGTCGCCG
GTGTGGAACGAGTGCTTCGAGGTCAGCGTGCCATCGCGGACAGCGGCCGACTTCGTGGTCAACGTCTACGACTAC
GACTTCGCCGACAAGCCTGACTTCCTCGGGGCGGCCGTCATCAAGCTGGCGGCACTGGAGCCGTTCAAGCCGCTC
GAGACGCATTACCCCTTGGACGGCAAGTCGGGCAGCGTACGGATCCGGATGCTGTTCCGGCCGGACTACGTGACT
CGGTCCGTACACGGCACGTCGACCTTTTCCGGCACCTTTGGCCCCGGGCGGATCGTTACGGGCGTGGCCGGGGCG
CCCATCAAGGGCGGCGTGGCCGTGGCCGGTGCTGTCGGACACGGCGTGGGCCGGGGGGCGTCGAGGCTGAAGCGC
GGCATCTTTGGGAAGAAGGACGTGGACGAGGTCAACGGGCCGACGATGGCGATTGACGGGCCGGACGGTGAAGGC
ACCTCGATGTTGACGCGGCTGCCGACGGTGACGCATCAGGAGCCGGAGCCCATGACGTCGCGTCACAACTCGTTC
AGCCGCGGACGCACCAAGAGCCTGACGGCGTCTTCCATGCACAGCATGAGTCCGGGCGGGGCGTCGGGAAGGGCC
ACTTTCACCGTGGTCAAGGCCTCGGGCTTCCCGGCCGGGACGGACCTTTACGTGGTGGTGTCGCAGATGGCGCCC
AAGGAGAAGACGGTGGGCAAGACGAAGCACTTCAAGTCGTCGTCGGCCGAGTGGACCTTTGACGAGACGTTCAGC
GCGCGGTGCAGCTCGGACGCGCAGTTCCGGATCGAGGCCAAGGTGGACCGCTTCATCGGTAGCGACGAGGCGCTG
GGCGAGCACGTCTACTTTGTGGACGAGACGGGGACGGGGACTGCCAAGGAGCTTCCGGTCGGATCCGGGTCCGTC
ATCATCAAGAGCAGCTTCCAGCCGTCGGACGAGGCGGCCGAGTCGCCGCGGGCGCATAACCTGCGGCGCAGCTTC
TTGGGGAAGCGAGGCGAGGGGCGGTCGAGCAGGGAGGCGACGCCCAACGCTCCATAG
Transcript >Ophun1|5354
ATGTCTGCCTTGGAGGAGACGGAGCTCAAGGCTCAGGGCGTCATCGAGGCGGCCGAAAATCCGCAGAGCCTGATA
TCGGCTGATGAGGCCGAGAGGGAAATCGTTGAGCTGTCCAAGAATGCTGGTGTCACGGCCTTCAATTTCGACCCG
GACGCCAGCGTGGCGCAGAAGCGCGCGCAAGCTCGGGCTGCTATCCCTCCGGAGCTTCAGCAGAGCCGGCGCGAG
AAAGGAGCGGCCATCATCACCGATCAGGACGATGGTGCAGGCCCGGATGAGGACCTGCCCGAGCCGAGCAAGGCT
GGCGTTCTTGATGTAGCCACGACCGGAGACGGCAAGCAGATCGTGGCTGGCGCCGACCCGTTGGCAGCCGAGGAG
CCCTTCTCCCGTACCGGATGGTCGCCTCAGATGGGCTGGCCCGATTCCAGCGCCCTGGAGGGAGATAGTCTACTG
GATCACGGCACCTGGGTCGAGGGCAAGCTCCCGGACACTCTCTACGGTGACTGGTATCACAATGCTGCCATCATC
GTCTTCGCCTGTATCTCGTCGTGGCTCATTGCCGTCCTCGGCGGAGGTCTGGCCTGGGTCACCATCATCATGGCC
GTCTGCGCCACCTACTACCGAACCTCGCTCCGGCGCGTGCGTCGCAACTTCCGGGACGACGTCACGAGAGAGCTG
GCCATGAAGAAGCTCGATACGGACAACGAGTCCCTCGAGTGGATCAACTCGTTTCTCGTCAAGTTTTGGCCCATA
TACCAGCCCGTTCTAGCCCAGACCATCATCAACTCGGTCGATCAGGTCCTCAGTTCCGCTACGCCCGCCTTCCTC
GACAGCTTGAAGCTCAAGACGTTTACGCTCGGGTCTAAACCACCGCGCATGGAGCACGTCAAGACGTACCCCAAG
ACCGAGGACGATATTGTCATGATGGACTGGAAGTTCAGCTTCACGCCAAACGACACGGCCGACATGACGGCTCGT
CAGATCAAGAACAAGATCAACCCGAAGGTGGTGCTCGAGATCCGTATCGGCAAGGCCATGATCAGCAAGGGCTTC
GACGTCATCGTCGAGGACATGGCCTTTTCCGGCATCATGCGGCTGAGGATCAAATTGCAGATACCCTTCCCCCAC
GTTGACCGTGTAGAGATGTGCTTCCTCGAGCGTCCGACCATCGACTACGTCTGTAAGCCCCTGGGTGGCGACAAT
TTGGGCTTCGACATCAACTTCATCCCGGGCCTCGAGACCTTTATCCTCGAGCAGATCCACGGCAACCTCTCGCCC
ATGATGTACGCCCCCAACGTCTTCCCCATCGAGGTGGCCAAGATGCTGGCCGGCACGCCCGTCGACCAGGCCGTC
GGCGTGCTCGCCCTGACGCTCCACGGCGCCCAGGGCCTCAAGAATACGGACAACTTTGGTGGCACCATCGACCCG
TATGCCTCCATCAGCTTCAGTCGACGCCAGGAGCTCGCGAGGACCAAGACGATCGACGACAACCCCAATCCGAGG
TGGAACGAGACGCACTACCTCATCGTTACGTCCTTTAGTGACACGGTCGACATTCAAGTCTTTGACAAGAATGAA
TTCCGCAAGTCCAAGGAGCTGGGAGTGGCCTCGTTCTACCTCGAGGACCTCCTCGATGACCCTGTGTATGAGAAC
GAGCGTCTTGAAGTCATCTCCAACGGCAAGGCGCGCGGCATCGTCTCGTGTGACCTGCGCTTCTTCCCCGTCCTC
GAGGCGGAGAAGACGCCCGACGGCAAGATGGAGCCGCCACCGCCGTCGAACCAGGGAATCTTACGCTTCACTGTC
GAGCAGGCCAAGGATCTTGATGGCACCAAGAGTCTCTACGGCCTGCTGAACCCTTACGCCGTCATGTTCATCAAC
GGCAAGACGATGCATCAGACCAAGAAGCTGAAGCGCACCAACAACCCCATCTGGGACAACGGCTCCAAGGAGATA
CTCATCACGGACCGCAAAAAGGCCAAGCTCGGCGTCACCATCAAGGACGATCGCGACCTGGCGGCCGACCAAGAG
CTCGGCAAGTACCAGATCAGGCTGGACGAGATGCTCGAATGCATGGAGCAGGGCAAGGAGTGGTACCAGCTGTCT
GGCGCCCAGACGGGCCGCGTCAAGATGATGGCCCAGTGGAGGCCCGTGGCCATCTCGGGCGTCGCCGGCACCGGA
GGTTATCTCACGCCCATCGGAGTCATGCGGCTGCACTTCGTCCGGGCCACTGATCTGCGTAATCTCGAGGCCTTT
GGCAAGTCGGATCCGTATGTCCGCGTGATGCTCTCGGGCATCGACAAGGCACGGACCGTGACGTTCAAGAACGAC
CTCAACCCGGAGTGGGACGAGGTCCTTTACGTGCCCATCCACTCGGACCGCGACAGGCTCACTCTCGAGGTGATG
GATTTCGAAAAGGTGGGCAAGGACCGGAGCCTGGGCGCCCTCGAGCTGTTCGCCTCCGACTACGTCCGCGAGGCC
GAAAATGGCGAGTTCCTGGTCCACGACGACAAGCATGTCCGTGAAGAGGGCCTGCGTATGCACGGCAAGGGCATC
GCCAAGGGGACTCTGACTTACACGGCCTCTTTCTTCCCCTGCCTCAACGTCGCGGATCCCGAGGACGAGGAGAAG
GAGGAGAAGGAGAAGGAGCAGAAGGAAAAGGAGCACCAGGCGGCTGAAAAGGGAGACACAGAGACTGCCAAAAAG
GACGGCGTAAAGGCGGCGGCGACGACCACGGACGAAAAGGAGCCCTTGCGGCGATCAATGTCGACAAAGGGGGGA
CGCTCGTCACAGGAAGACGATGGACCACCCAAGATCCGGCTCACGCCCGAGGAGCTCCTCAAGCACGAGAGCGGA
CTGCTCATCTTTTCCCTGCTGGAGGCGGAGCTTCCGGACAACAACAGCCGGCTGGAGGTCTGGGTCGACGACATG
GCCTACCCTTCGTACGTGTCTTCGGCGGCACCGTCGCGGACTCACAAGTTTGACGAGATTGGCGACTGTGTGATC
CGCGAGCTGGATGTGTCGCGGCTTATTCTCAAGGCGCGCAAGAAGGGAGACGACAAGGACGAGACGGTGGCCCAG
CTGGCAGGCAACACGATGGAGACGCTCAAGCAGTGTCTGAACAACCCGACGAAGCTCAAGCTCAAGACCGAGGAC
GGCAAGGACGGTTGGGTCAAGGTCAGCCTCAAGTACATACCCATCAAGATGCAGCTGGACCCGAGCGAGAGCATC
AACAACATGGGCAAGCTCCGGGTCGACATCCTGGACGGCACGGACCTGCCTTCGGCGGACCGCAACGGGAAGAGT
GACCCCTACTGCCGGTTCGAGCTCAACGGGCACGAGGTGTACAAGACCAAGATCATCAAGAAGACGCTGTCGCCG
GTGTGGAACGAGTGCTTCGAGGTCAGCGTGCCATCGCGGACAGCGGCCGACTTCGTGGTCAACGTCTACGACTAC
GACTTCGCCGACAAGCCTGACTTCCTCGGGGCGGCCGTCATCAAGCTGGCGGCACTGGAGCCGTTCAAGCCGCTC
GAGACGCATTACCCCTTGGACGGCAAGTCGGGCAGCGTACGGATCCGGATGCTGTTCCGGCCGGACTACGTGACT
CGGTCCGTACACGGCACGTCGACCTTTTCCGGCACCTTTGGCCCCGGGCGGATCGTTACGGGCGTGGCCGGGGCG
CCCATCAAGGGCGGCGTGGCCGTGGCCGGTGCTGTCGGACACGGCGTGGGCCGGGGGGCGTCGAGGCTGAAGCGC
GGCATCTTTGGGAAGAAGGACGTGGACGAGGTCAACGGGCCGACGATGGCGATTGACGGGCCGGACGGTGAAGGC
ACCTCGATGTTGACGCGGCTGCCGACGGTGACGCATCAGGAGCCGGAGCCCATGACGTCGCGTCACAACTCGTTC
AGCCGCGGACGCACCAAGAGCCTGACGGCGTCTTCCATGCACAGCATGAGTCCGGGCGGGGCGTCGGGAAGGGCC
ACTTTCACCGTGGTCAAGGCCTCGGGCTTCCCGGCCGGGACGGACCTTTACGTGGTGGTGTCGCAGATGGCGCCC
AAGGAGAAGACGGTGGGCAAGACGAAGCACTTCAAGTCGTCGTCGGCCGAGTGGACCTTTGACGAGACGTTCAGC
GCGCGGTGCAGCTCGGACGCGCAGTTCCGGATCGAGGCCAAGGTGGACCGCTTCATCGGTAGCGACGAGGCGCTG
GGCGAGCACGTCTACTTTGTGGACGAGACGGGGACGGGGACTGCCAAGGAGCTTCCGGTCGGATCCGGGTCCGTC
ATCATCAAGAGCAGCTTCCAGCCGTCGGACGAGGCGGCCGAGTCGCCGCGGGCGCATAACCTGCGGCGCAGCTTC
TTGGGGAAGCGAGGCGAGGGGCGGTCGAGCAGGGAGGCGACGCCCAACGCTCCATAG
Gene >Ophun1|5354
ATGTCTGCCTTGGAGGAGACGGAGCTCAAGGCTCAGGGCGTCATCGAGGCGGCCGAAAATCCGCAGAGCCTGATA
TCGGCTGATGAGGCCGAGAGGGAAATCGTTGAGCTGTCCAAGAATGCTGGTGTCACGGCCTTCAATTTCGACCCG
GACGCCAGCGTGGCGCAGAAGCGCGCGCAAGCTCGGGCTGTAGGTTGAAGCTCAAACGCTGGGCCGTCCGAGTCC
TCGACTAATGCCTCCCAGGCTATCCCTCCGGAGCTTCAGCAGAGCCGGCGCGAGAAAGGAGCGGCCATCATCACC
GATCAGGACGATGGTGCAGGCCCGGATGAGGACCTGCCCGAGCCGAGCAAGGCTGGCGTTCTTGATGTAGCCACG
ACCGGAGACGGCAAGCAGATCGTGGCTGGCGCCGACCCGTTGGCAGCCGAGGAGCCCTTCTCCCGTACCGGATGG
TCGCCTCAGATGGGCTGGCCCGATTCCAGCGCCCTGGAGGGAGATAGTCTACTGGATCACGGCACCTGGGTCGAG
GGCAAGCTCCCGGACACTCTCTACGGTGGTGAGTGCGGAATCGACGTCGCCCGACGGGGACGCTTGGCTGACTTG
TCTCTCCAGACTGGTATCACAATGCTGCCATCATCGTCTTCGCCTGTATCTCGTCGTGGCTCATTGCCGTCCTCG
GCGGAGGTCTGGCCTGGGTCACCATCATCATGGCCGTCTGCGCCACCTACTACCGAACCTCGCTCCGGCGCGTGC
GTCGCAACTTCCGGGACGACGTCACGAGAGAGCTGGCCATGAAGAAGCTCGATACGGACAACGAGTCCCTCGAGT
GGATCAACTCGTTTCTCGTCAAGTTTTGGCCCATATACCAGCCCGTTCTAGCCCAGACCATCATCAACTCGGTCG
ATCAGGTCCTCAGTTCCGCTACGCCCGCCTTCCTCGACAGCTTGAAGCTCAAGACGTTTACGCTCGGGTCTAAAC
CACCGCGCATGGAGCACGTCAAGACGTACCCCAAGACCGAGGACGATATTGTCATGATGGACTGGAAGTTCAGCT
TCACGCCAAACGACACGGCCGACATGACGGCTCGTCAGATCAAGAACAAGATCAACCCGAAGGTGGTGCTCGAGA
TCCGTATCGGCAAGGCCATGATCAGCAAGGGCTTCGACGTCATCGTCGAGGACATGGCCTTTTCCGGCATCATGC
GGCTGAGGATCAAATTGCAGATACCCTTCCCCCACGTTGACCGTGTAGAGATGTGCTTCCTCGAGCGTCCGACCA
TCGACTACGTCTGTAAGCCCCTGGGTGGCGACAATTTGGGCTTCGACATCAACTTCATCCCGGGCCTCGAGACCT
TTATCCTCGAGCAGATCCACGGCAACCTCTCGCCCATGATGTACGCCCCCAACGTCTTCCCCATCGAGGTGGCCA
AGATGCTGGCCGGCACGCCCGTCGACCAGGCCGTCGGCGTGCTCGCCCTGACGCTCCACGGCGCCCAGGGCCTCA
AGAATACGGACAACTTTGGTGGCACCATCGACCCGTATGCCTCCATCAGCTTCAGTCGACGCCAGGAGCTCGCGA
GGACCAAGACGATCGACGACAACCCCAATCCGAGGTGGAACGAGACGCACTACCTCATCGTTACGTCCTTTAGTG
ACACGGTCGACATTCAAGTCTTTGACAAGAATGAATTCCGCAAGTCCAAGGAGCTGGGAGTGGCCTCGTTCTACC
TCGAGGACCTCCTCGATGACCCTGTGTATGAGAACGAGCGTCTTGAAGTCATCTCCAACGGCAAGGCGCGCGGCA
TCGTCTCGTGTGACCTGCGCTTCTTCCCCGTCCTCGAGGCGGAGAAGACGCCCGACGGCAAGATGGAGCCGCCAC
CGCCGTCGAACCAGGGAATCTTACGCTTCACTGTCGAGCAGGCCAAGGATCTTGATGGCACCAAGAGTCTCTACG
GCCTGCTGAACCCTTACGCCGTCATGTTCATCAACGGCAAGACGATGCATCAGACCAAGAAGCTGAAGCGCACCA
ACAACCCCATCTGGGACAACGGCTCCAAGGAGATACTCATCACGGACCGCAAAAAGGCCAAGCTCGGCGTCACCA
TCAAGGACGATCGCGACCTGGCGGCCGACCAAGAGCTCGGCAAGTACCAGATCAGGCTGGACGAGATGCTCGAAT
GCATGGAGCAGGGCAAGGAGTGGTACCAGCTGTCTGGCGCCCAGACGGGCCGCGTCAAGATGATGGCCCAGTGGA
GGCCCGTGGCCATCTCGGGCGTCGCCGGCACCGGAGGTTATCTCACGCCCATCGGAGTCATGCGGCTGCACTTCG
TCCGGGCCACTGATCTGCGTAATCTCGAGGCCTTTGGCAAGTCGGATCCGTATGTCCGCGTGATGCTCTCGGGCA
TCGACAAGGCACGGACCGTGACGTTCAAGAACGACCTCAACCCGGAGTGGGACGAGGTCCTTTACGTGCCCATCC
ACTCGGACCGCGACAGGCTCACTCTCGAGGTGATGGATTTCGAAAAGGTGGGCAAGGACCGGAGCCTGGGCGCCC
TCGAGCTGTTCGCCTCCGACTACGTCCGCGAGGCCGAAAATGGCGAGTTCCTGGTCCACGACGACAAGCATGTCC
GTGAAGAGGGCCTGCGTATGCACGGCAAGGGCATCGCCAAGGGGACTCTGACTTACACGGCCTCTTTCTTCCCCT
GCCTCAACGTCGCGGATCCCGAGGACGAGGAGAAGGAGGAGAAGGAGAAGGAGCAGAAGGAAAAGGAGCACCAGG
CGGCTGAAAAGGGAGACACAGAGACTGCCAAAAAGGACGGCGTAAAGGCGGCGGCGACGACCACGGACGAAAAGG
AGCCCTTGCGGCGATCAATGTCGACAAAGGGGGGACGCTCGTCACAGGAAGACGATGGACCACCCAAGATCCGGC
TCACGCCCGAGGAGCTCCTCAAGCACGAGAGCGGACTGCTCATCTTTTCCCTGCTGGAGGCGGAGCTTCCGGACA
ACAACAGCCGGCTGGAGGTCTGGGTCGACGACATGGCCTACCCTTCGTACGTGTCTTCGGCGGCACCGTCGCGGA
CTCACAAGTTTGACGAGATTGGCGACTGTGTGATCCGCGAGCTGGATGTGTCGCGGCTTATTCTCAAGGCGCGCA
AGAAGGGAGACGACAAGGACGAGACGGTGGCCCAGCTGGCAGGCAACACGATGGAGACGCTCAAGCAGTGTCTGG
TGAGTTTGTGGAAGAGAACAAGGGACGTCATCCTGGCTGACATTGGTGGCAGAACAACCCGACGAAGCTCAAGCT
CAAGACCGAGGACGGCAAGGACGGTTGGGTCAAGGTCAGCCTCAAGTACATACCCATCAAGATGCAGCTGGACCC
GAGCGAGAGCATCAACAACATGGGCAAGCTCCGGGTCGACATCCTGGACGGCACGGACCTGCCTTCGGCGGACCG
CAACGGGAAGAGTGACCCCTACTGCCGGTTCGAGCTCAACGGGCACGAGGTGTACAAGACCAAGATCATCAAGAA
GACGCTGTCGCCGGTGTGGAACGAGTGCTTCGAGGTCAGCGTGCCATCGCGGACAGCGGCCGACTTCGTGGTCAA
CGTCTACGACTACGACTTCGCCGACAAGCCTGACTTCCTCGGGGCGGCCGTCATCAAGCTGGCGGCACTGGAGCC
GTTCAAGCCGCTCGAGACGCATTACCCCTTGGACGGCAAGTCGGGCAGCGTACGGATCCGGATGCTGTTCCGGCC
GGACTACGTGACTCGGTCCGTACACGGCACGTCGACCTTTTCCGGCACCTTTGGCCCCGGGCGGATCGTTACGGG
CGTGGCCGGGGCGCCCATCAAGGGCGGCGTGGCCGTGGCCGGTGCTGTCGGACACGGCGTGGGCCGGGGGGCGTC
GAGGCTGAAGCGCGGCATCTTTGGGAAGAAGGACGTGGACGAGGTCAACGGGCCGACGATGGCGATTGACGGGCC
GGACGGTGAAGGCACCTCGATGTTGACGCGGCTGCCGACGGTGACGCATCAGGAGCCGGAGCCCATGACGTCGCG
TCACAACTCGTTCAGCCGCGGACGCACCAAGAGCCTGACGGCGTCTTCCATGCACAGCATGAGTCCGGGCGGGGC
GTCGGGAAGGGCCACTTTCACCGTGGTCAAGGCCTCGGGCTTCCCGGCCGGGACGGACCTTTACGTGGTGGTGTC
GCAGATGGCGCCCAAGGAGAAGACGGTGGGCAAGACGAAGCACTTCAAGTCGTCGTCGGCCGAGTGGACCTTTGA
CGAGACGTTCAGCGCGCGGTGCAGCTCGGACGCGCAGTTCCGGATCGAGGCCAAGGTGGACCGCTTCATCGGTAG
CGACGAGGCGCTGGGCGAGCACGTCTACTTTGTGGACGAGACGGGGACGGGGACTGCCAAGGAGCTTCCGGTCGG
ATCCGGGTCCGTCATCATCAAGAGCAGCTTCCAGCCGTCGGACGAGGCGGCCGAGTCGCCGCGGGCGCATAACCT
GCGGCGCAGCTTCTTGGGGAAGCGAGGCGAGGGGCGGTCGAGCAGGGAGGCGACGCCCAACGCTCCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail