Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5351
Gene name
LocationContig_524:140..1338
Strand+
Gene length (bp)1198
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07938 Fungal_lectin Fungal fucose-specific lectin 2.4E-32 10 312

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AL26|LECF_ARTBC Fucose-specific lectin OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05022 PE=1 SV=1 8 312 1.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5351
MSDDITLGAGFAVCTNDEHSIRIYLMDVHGEIREIHRNSGNWHKGSSLSHLQEGDGKVGTCVGASSIGLDFINVY
FIRGSDLRVRAIAYGDGGDHWGADIMCRQNWFASATAKCIAATIIDKKQHMRRCYWQFDDHHVWEVVQREESFAG
SSPSWQWGRGADFGPAMKGTGVACIAWGEVPGNMRVFFQNEKGVIIEKAWDGSSWSTREITDITDAVARTPLAVA
QMDDDHIRLFYVNREWKVKEKITTIRRVSHWGNGWIDIKVAANTHIAATSRPFNTIYVQEGTNGSAISEWSWAMK
GRSWTRTKESIPVS*
Coding >Ophun1|5351
ATGTCTGACGACATCACCCTGGGTGCTGGCTTCGCCGTCTGCACCAACGATGAGCATAGCATCAGAATCTATCTC
ATGGACGTCCATGGCGAAATTCGTGAGATTCATAGAAACAGCGGTAATTGGCACAAGGGCAGCTCGCTTTCCCAC
CTTCAGGAGGGAGATGGAAAGGTCGGCACCTGCGTCGGCGCTTCATCCATTGGCCTGGATTTCATCAATGTTTAC
TTTATCAGGGGTTCGGATTTGAGGGTCAGGGCGATTGCGTATGGGGACGGTGGTGATCACTGGGGCGCGGACATC
ATGTGCAGGCAAAATTGGTTTGCATCCGCAACCGCCAAATGCATTGCGGCGACCATCATAGACAAGAAGCAGCAC
ATGCGGCGCTGCTACTGGCAGTTCGACGACCACCACGTCTGGGAAGTCGTCCAGCGTGAGGAGAGCTTTGCTGGG
TCCAGTCCTTCGTGGCAGTGGGGAAGAGGAGCCGACTTTGGCCCTGCCATGAAGGGAACCGGGGTTGCTTGCATT
GCCTGGGGCGAGGTGCCGGGCAACATGCGTGTCTTCTTCCAGAATGAAAAGGGCGTCATCATCGAAAAGGCATGG
GATGGTTCTTCATGGTCGACCCGTGAAATCACCGATATCACAGATGCCGTGGCTCGCACACCCCTTGCCGTTGCC
CAAATGGACGACGATCATATCCGGCTCTTCTACGTTAATCGCGAGTGGAAAGTCAAGGAGAAGATCACCACCATC
AGGCGTGTCTCTCATTGGGGAAATGGCTGGATCGACATCAAAGTCGCGGCCAACACCCATATCGCCGCCACGAGC
CGTCCCTTCAATACCATCTATGTTCAGGAGGGCACCAACGGCTCGGCCATTTCTGAGTGGTCGTGGGCCATGAAG
GGAAGATCGTGGACCAGGACCAAGGAATCCATTCCGGTTTCTTAG
Transcript >Ophun1|5351
ATGTCTGACGACATCACCCTGGGTGCTGGCTTCGCCGTCTGCACCAACGATGAGCATAGCATCAGAATCTATCTC
ATGGACGTCCATGGCGAAATTCGTGAGATTCATAGAAACAGCGGTAATTGGCACAAGGGCAGCTCGCTTTCCCAC
CTTCAGGAGGGAGATGGAAAGGTCGGCACCTGCGTCGGCGCTTCATCCATTGGCCTGGATTTCATCAATGTTTAC
TTTATCAGGGGTTCGGATTTGAGGGTCAGGGCGATTGCGTATGGGGACGGTGGTGATCACTGGGGCGCGGACATC
ATGTGCAGGCAAAATTGGTTTGCATCCGCAACCGCCAAATGCATTGCGGCGACCATCATAGACAAGAAGCAGCAC
ATGCGGCGCTGCTACTGGCAGTTCGACGACCACCACGTCTGGGAAGTCGTCCAGCGTGAGGAGAGCTTTGCTGGG
TCCAGTCCTTCGTGGCAGTGGGGAAGAGGAGCCGACTTTGGCCCTGCCATGAAGGGAACCGGGGTTGCTTGCATT
GCCTGGGGCGAGGTGCCGGGCAACATGCGTGTCTTCTTCCAGAATGAAAAGGGCGTCATCATCGAAAAGGCATGG
GATGGTTCTTCATGGTCGACCCGTGAAATCACCGATATCACAGATGCCGTGGCTCGCACACCCCTTGCCGTTGCC
CAAATGGACGACGATCATATCCGGCTCTTCTACGTTAATCGCGAGTGGAAAGTCAAGGAGAAGATCACCACCATC
AGGCGTGTCTCTCATTGGGGAAATGGCTGGATCGACATCAAAGTCGCGGCCAACACCCATATCGCCGCCACGAGC
CGTCCCTTCAATACCATCTATGTTCAGGAGGGCACCAACGGCTCGGCCATTTCTGAGTGGTCGTGGGCCATGAAG
GGAAGATCGTGGACCAGGACCAAGGAATCCATTCCGGTTTCTTAG
Gene >Ophun1|5351
ATGTCTGACGACATCACCCTGGGTGCTGGCTTCGCCGTCTGCACCAACGATGAGCATAGCATCAGAATCTATCTC
ATGGACGTCCATGGCGAAATTCGTGAGATTCATAGAAACAGCGGTAATTGGCACAAGGGCAGCTCGCTTTCCCAC
CTTCAGGAGGGAGATGGAAAGGTCGGCACCTGCGTCGGCGCTTCATCCATTGGCCTGGATTTCATCAATGTTTAC
TTTATCAGGGGTTCGGATTTGAGGGTCAGGGCGATTGCGTATGGGGACGGTGGTGATCACTGGGTGAGTCATGGT
TCTCTCTCTCTCTCTGTCTCTCTCTCTCTCATACACACACAAGCACACACTCTCCCACCCTCCCTCTACACCTTT
TCTTATGCCACAACTGTATCCTAACCCGCCGTACAGGGCGCGGACATCATGTGCAGGCAAAATTGGTTTGCATCC
GCAACCGCCAAATGCATTGCGGCGACCATCATAGACAAGAAGCAGCACATGCGGCGCTGCTACTGGCAGTTCGAC
GACCACCACGTCTGGGAAGTCGTCCGTAAGTTTCGCGTCCCGTTGCCTCAGAACTTGGGCGTTTGATGCTGAAGC
CGGTTTCAATCCCACAGAGCGTGAGGAGAGCTTTGCTGGGTCCAGTCCTTCGTGGCAGTGGGGAAGAGGAGCCGA
CTTTGGCCCTGCCATGAAGGGAACCGGGGTTGCTTGCATTGCCTGGGGCGAGGTGCCGGGCAACATGCGGTGAGT
GGCCTCTTGTTGTGCTTCCACATCAGCCTCGTCCGTCCGCTGACAGCGTCATGGCAGTGTCTTCTTCCAGAATGA
AAAGGGCGTCATCATCGAAAAGGCATGGGATGGTTCTTCATGGTCGACCCGTGAAATCACCGATATCACAGATGC
CGTGGCTCGCACACCCCTTGCCGTTGCCCAAATGGACGACGATCATATCCGGCTCTTCTACGTTAATCGCGAGTG
GAAAGTCAAGGAGAAGATCACCACCATCAGGCGTGTCTCTCATTGGGGAAATGGCTGGATCGACATCAAAGTCGC
GGCCAACACCCATATCGCCGCCACGAGCCGTCCCTTCAATACCATCTATGTTCAGGAGGGCACCAACGGCTCGGC
CATTTCTGAGTGGTCGTGGGCCATGAAGGGAAGATCGTGGACCAGGACCAAGGAATCCATTCCGGTTTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail