Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|535
Gene name
LocationContig_116:34043..35731
Strand+
Gene length (bp)1688
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08219 TOM13 Outer membrane protein TOM13 9.9E-35 1 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0G8|MIM1_NEUCR Mitochondrial import protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B13O8.080 PE=3 SV=1 1 95 2.0E-35
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 247 419 1.0E-17
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 187 419 2.0E-16
sp|Q42191|OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana GN=OXA1 PE=2 SV=2 235 419 1.0E-11
sp|Q08176|MIM1_YEAST Mitochondrial import protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIM1 PE=1 SV=1 3 84 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8X0G8|MIM1_NEUCR Mitochondrial import protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B13O8.080 PE=3 SV=1 1 95 2.0E-35
sp|O13375|OXA1_KAZSE Mitochondrial inner membrane protein OXA1 OS=Kazachstania servazzii GN=OXA1 PE=3 SV=1 247 419 1.0E-17
sp|P39952|OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OXA1 PE=1 SV=1 187 419 2.0E-16
sp|Q42191|OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana GN=OXA1 PE=2 SV=2 235 419 1.0E-11
sp|Q08176|MIM1_YEAST Mitochondrial import protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIM1 PE=1 SV=1 3 84 1.0E-10
sp|Q8BGA9|OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus GN=Oxa1l PE=1 SV=1 241 418 1.0E-10
sp|O66561|OXAA_AQUAE Membrane protein insertase YidC OS=Aquifex aeolicus (strain VF5) GN=yidC PE=3 SV=1 254 434 4.0E-10
sp|O43092|OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa102 PE=2 SV=2 261 422 6.0E-10
sp|Q9C1W7|MIM1_SCHPO Mitochondrial import protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mim1 PE=3 SV=1 31 83 1.0E-08
sp|P62512|MIM1_ASHGO Mitochondrial import protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AAR013W PE=3 SV=1 41 114 3.0E-08
sp|O14300|OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oxa101 PE=2 SV=1 258 419 3.0E-08
sp|Q15070|OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens GN=OXA1L PE=1 SV=3 243 418 2.0E-07
sp|Q3SYV3|OXA1L_BOVIN Mitochondrial inner membrane protein OXA1L OS=Bos taurus GN=OXA1L PE=2 SV=1 241 418 3.0E-07
sp|Q4UNK8|YIDC_XANC8 Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=yidC PE=3 SV=1 271 434 4.0E-07
sp|Q8P338|YIDC_XANCP Membrane protein insertase YidC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=yidC PE=3 SV=1 271 434 5.0E-07
sp|Q8PEH7|YIDC_XANAC Membrane protein insertase YidC OS=Xanthomonas axonopodis pv. citri (strain 306) GN=yidC PE=3 SV=1 271 434 1.0E-06
sp|Q3BLZ7|YIDC_XANC5 Membrane protein insertase YidC OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=yidC PE=3 SV=1 271 434 1.0E-06
sp|Q9SKD3|OXA1L_ARATH Mitochondrial inner membrane protein OXA1-like OS=Arabidopsis thaliana GN=OXA1L PE=2 SV=1 265 422 1.0E-06
sp|B2JJR8|YIDC_BURP8 Membrane protein insertase YidC OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=yidC PE=3 SV=1 221 434 6.0E-06
sp|Q5P4P4|YIDC_AROAE Membrane protein insertase YidC OS=Aromatoleum aromaticum (strain EbN1) GN=yidC PE=3 SV=1 257 419 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005741 mitochondrial outer membrane Yes
GO:0031966 mitochondrial membrane No
GO:0031090 organelle membrane No
GO:0031968 organelle outer membrane No
GO:0019867 outer membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0098588 bounding membrane of organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 278 300 22
2 357 379 22
3 407 424 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|535
MHSDSEQYSPGAEDLSVSPPSSGDPVVLYQPPTTWSLLRGAAINLVLPFINGMMLGFGELFAHEAAFRLGWGGTK
VFPLSRRRAHPIGPGIEILKLSLQELQQPQPTMLPSRGATLVFSGATSRIPARSFVFPGAGRGFGTLRQAGPSPW
PSRRRRLVVGSSAPSATRQLSLWGWSPSLPGWPSSVPGWAWATGSPKSKPAPEAELIPPIQPVAVEPTTTPLQAI
PSTEIDTTLLSEALTAEDILNLPIEPGYLRALGLDYGWGPTSVMQWTIEHVHVYTGLGWAATIVTTAFLLRVMML
YPQYRSLKFGVSMQRMKEDPRAEAALKLGQEAAADRNMEKQMQSRLVYKTLQKEYGFSGWGMMWSIGQIPFGYGL
FRIINGMAGIPVPSFESAGWLWFPDLAAKDPYFILPVVGTSLMILSVTVRNPPSISPTQLT*
Coding >Ophun1|535
ATGCACTCAGACAGCGAGCAGTACTCGCCAGGAGCAGAGGACCTCTCCGTCTCGCCCCCCAGCTCGGGCGACCCC
GTGGTGCTATACCAGCCGCCGACCACGTGGTCGCTCCTCCGGGGCGCGGCCATCAACCTCGTCCTTCCCTTTATC
AACGGCATGATGCTCGGCTTTGGGGAGCTTTTCGCTCATGAGGCTGCCTTTCGGCTTGGTTGGGGCGGCACAAAG
GTATTTCCCCTTTCGCGCAGGAGAGCTCATCCCATCGGTCCGGGCATCGAGATCCTCAAGCTCAGCCTCCAAGAG
CTCCAACAACCACAACCCACCATGCTTCCCAGCCGGGGAGCCACCCTCGTCTTCTCCGGAGCAACGAGCCGGATC
CCCGCGCGCAGCTTCGTCTTTCCCGGTGCAGGCCGTGGCTTCGGCACGTTGCGACAGGCAGGACCCTCGCCATGG
CCTTCGCGAAGACGTCGTCTCGTTGTTGGTAGTTCCGCTCCGTCGGCTACGCGACAGCTTTCGCTTTGGGGGTGG
TCGCCTTCTCTCCCCGGGTGGCCTTCTTCCGTCCCAGGCTGGGCATGGGCCACGGGCAGCCCTAAAAGCAAGCCA
GCTCCAGAAGCCGAACTCATCCCCCCCATCCAACCCGTCGCCGTCGAACCCACCACAACCCCCTTACAAGCCATC
CCCTCCACCGAAATCGACACCACCCTCCTCTCCGAAGCCCTCACAGCCGAAGACATCCTCAACCTCCCCATCGAA
CCAGGCTACCTCCGAGCCCTGGGCCTCGACTACGGCTGGGGGCCAACCTCTGTCATGCAATGGACCATCGAACAC
GTCCACGTATACACAGGTCTAGGATGGGCCGCCACCATCGTGACGACCGCCTTCCTCCTCCGCGTCATGATGCTC
TACCCGCAGTACCGATCCCTTAAATTCGGCGTCTCCATGCAGCGCATGAAGGAGGACCCGCGCGCCGAAGCCGCC
CTCAAGCTGGGGCAGGAGGCCGCGGCGGATCGCAACATGGAGAAGCAGATGCAGAGCCGGTTGGTGTATAAGACG
CTGCAGAAGGAGTATGGCTTCAGCGGCTGGGGGATGATGTGGTCGATTGGGCAGATTCCCTTTGGCTATGGCCTG
TTTCGAATCATCAACGGCATGGCTGGCATCCCCGTTCCGTCGTTTGAGTCGGCAGGCTGGCTCTGGTTTCCCGAC
CTGGCCGCCAAAGACCCCTACTTTATCCTCCCCGTCGTCGGAACCAGCCTCATGATCCTATCCGTCACCGTACGA
AACCCCCCATCCATCTCCCCTACCCAGCTAACATGA
Transcript >Ophun1|535
ATGCACTCAGACAGCGAGCAGTACTCGCCAGGAGCAGAGGACCTCTCCGTCTCGCCCCCCAGCTCGGGCGACCCC
GTGGTGCTATACCAGCCGCCGACCACGTGGTCGCTCCTCCGGGGCGCGGCCATCAACCTCGTCCTTCCCTTTATC
AACGGCATGATGCTCGGCTTTGGGGAGCTTTTCGCTCATGAGGCTGCCTTTCGGCTTGGTTGGGGCGGCACAAAG
GTATTTCCCCTTTCGCGCAGGAGAGCTCATCCCATCGGTCCGGGCATCGAGATCCTCAAGCTCAGCCTCCAAGAG
CTCCAACAACCACAACCCACCATGCTTCCCAGCCGGGGAGCCACCCTCGTCTTCTCCGGAGCAACGAGCCGGATC
CCCGCGCGCAGCTTCGTCTTTCCCGGTGCAGGCCGTGGCTTCGGCACGTTGCGACAGGCAGGACCCTCGCCATGG
CCTTCGCGAAGACGTCGTCTCGTTGTTGGTAGTTCCGCTCCGTCGGCTACGCGACAGCTTTCGCTTTGGGGGTGG
TCGCCTTCTCTCCCCGGGTGGCCTTCTTCCGTCCCAGGCTGGGCATGGGCCACGGGCAGCCCTAAAAGCAAGCCA
GCTCCAGAAGCCGAACTCATCCCCCCCATCCAACCCGTCGCCGTCGAACCCACCACAACCCCCTTACAAGCCATC
CCCTCCACCGAAATCGACACCACCCTCCTCTCCGAAGCCCTCACAGCCGAAGACATCCTCAACCTCCCCATCGAA
CCAGGCTACCTCCGAGCCCTGGGCCTCGACTACGGCTGGGGGCCAACCTCTGTCATGCAATGGACCATCGAACAC
GTCCACGTATACACAGGTCTAGGATGGGCCGCCACCATCGTGACGACCGCCTTCCTCCTCCGCGTCATGATGCTC
TACCCGCAGTACCGATCCCTTAAATTCGGCGTCTCCATGCAGCGCATGAAGGAGGACCCGCGCGCCGAAGCCGCC
CTCAAGCTGGGGCAGGAGGCCGCGGCGGATCGCAACATGGAGAAGCAGATGCAGAGCCGGTTGGTGTATAAGACG
CTGCAGAAGGAGTATGGCTTCAGCGGCTGGGGGATGATGTGGTCGATTGGGCAGATTCCCTTTGGCTATGGCCTG
TTTCGAATCATCAACGGCATGGCTGGCATCCCCGTTCCGTCGTTTGAGTCGGCAGGCTGGCTCTGGTTTCCCGAC
CTGGCCGCCAAAGACCCCTACTTTATCCTCCCCGTCGTCGGAACCAGCCTCATGATCCTATCCGTCACCGTACGA
AACCCCCCATCCATCTCCCCTACCCAGCTAACATGA
Gene >Ophun1|535
ATGCACTCAGACAGCGAGCAGTACTCGCCAGGAGCAGAGGACCTCTCCGTCTCGCCCCCCAGCTCGGGCGACCCC
GTGGTGCTATACCAGCCGCCGACCACGTGGTCGCTCCTCCGGGGCGCGGCCATCAACCTCGTCCTTCCCTTTATC
AACGGCATGATGCTCGGCTTTGGGGAGCTTTTCGCTCATGAGGCTGCCTTTCGGCTTGGTTGGGGCGGCACAAAG
GTCGTTCTCTTTTCCTCTTCTCTATCTCTTGTTACATCTCATGGCTGACAAGCATCAAGGTATTTCCCCTTTCGC
GCAGGAGAGCTCATCCCATCGGTCCGGGCATCGAGGTACGAGATCGTCCCCGTCGGCCACCGGGCGTGTCGCTGG
ACGACTACGCGAGTCTGGAATAGAGAGTGTGTGTATGGACGGTGGAATGAATATAGAACGGGAGGTTTAGGCACG
GACAAGATCTTGTCGTACATGTCCATATCATCTGCCATCAGCATCATCGGCGTCCATCTACCTACTTCGTACGAA
TACAGTAGAAAGACGACTCCAAGCTCCCCCGTGATTCCACCGGCGACCCTCCGCCGAGAACCGGGGTCACCGGAT
AAACCCCGGCGCCAACCCCAATCAAACCCCCCCATAAAAAAAACCATCGCAAGATCCTCAAGCTCAGCCTCCAAG
AGCTCCAACAACCACAACCCACCATGCTTCCCAGCCGGGGAGCCACCCTCGTCTTCTCCGGAGCAACGAGCCGGA
TCCCCGCGCGCAGCTTCGTCTTTCCCGGTGCAGGCCGTGGCTTCGGCACGTTGCGACAGGCAGGACCCTCGCCAT
GGCCTTCGCGAAGACGTCGTCTCGTTGTTGGTAGTTCCGCTCCGTCGGCTACGCGACAGCTTTCGCTTTGGGGGT
GGTCGCCTTCTCTCCCCGGGTGGCCTTCTTCCGTCCCAGGCTGGGCATGGGCCACGGGCAGCCCTAAAAGCAAGC
CAGCTCCAGAAGCCGAACTCATCCCCCCCATCCAACCCGTCGCCGTCGAACCCACCACAACCCCCTTACAAGCCA
TCCCCTCCACCGAAATCGACACCACCCTCCTCTCCGAAGCCCTCACAGCCGAAGACATCCTCAACCTCCCCATCG
AACCAGGCTACCTCCGAGCCCTGGGCCTCGACTACGGCTGGGGGCCAACCTCTGTCATGCAATGGACCATCGAAC
ACGTCCACGTATACACAGGTCTAGGATGGGCCGCCACCATCGTGACGACCGCCTTCCTCCTCCGCGTCATGATGC
TCTACCCGCAGTACCGATCCCTTAAATTCGGCGTCTCCATGCAGCGCATGAAGGAGGACCCGCGCGCCGAAGCCG
CCCTCAAGCTGGGGCAGGAGGCCGCGGCGGATCGCAACATGGAGAAGCAGATGCAGAGCCGGTTGGTGTATAAGA
CGCTGCAGAAGGAGTATGGCTTCAGCGGCTGGGGGATGATGTGGTCGATTGGGCAGATTCCCTTTGGCTATGGCC
TGTTTCGAATCATCAACGGCATGGCTGGCATCCCCGTTCCGTCGTTTGAGTCGGCAGGCTGGCTCTGGTTTCCCG
ACCTGGCCGCCAAAGACCCCTACTTTATCCTCCCCGTCGTCGGAACCAGCCTCATGATCCTATCCGTCACCGTAC
GAAACCCCCCATCCATCTCCCCTACCCAGCTAACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail