Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5346
Gene name
LocationContig_521:7913..12946
Strand+
Gene length (bp)5033
Transcript length (bp)4950
Coding sequence length (bp)4950
Protein length (aa) 1650

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 2.5E-50 1021 1229
PF03836 RasGAP_C RasGAP C-terminus 1.5E-47 1429 1569
PF00612 IQ IQ calmodulin-binding motif 3.2E-03 498 518
PF00307 CH Calponin homology (CH) domain 2.2E-10 268 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 252 1646 0.0E+00
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 259 1646 2.0E-158
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 665 1646 2.0E-140
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 742 1646 8.0E-139
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 739 1646 1.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14188|RNG2_SCHPO Ras GTPase-activating-like protein rng2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rng2 PE=1 SV=1 252 1646 0.0E+00
sp|Q5AH02|IQG1_CANAL Ras GTPase-activating-like protein IQG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IQG1 PE=1 SV=1 259 1646 2.0E-158
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 665 1646 2.0E-140
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 742 1646 8.0E-139
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 739 1646 1.0E-138
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 744 1646 1.0E-135
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 737 1647 3.0E-111
sp|Q12280|IQG1_YEAST Ras GTPase-activating-like protein IQG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IQG1 PE=1 SV=1 257 1647 4.0E-82
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 880 1600 2.0E-67
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 880 1648 5.0E-51
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 250 415 3.0E-34
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 250 415 8.0E-34
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 250 415 1.0E-33
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 250 415 2.0E-33
sp|Q86VI3|IQGA3_HUMAN Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens GN=IQGAP3 PE=1 SV=2 250 415 8.0E-31
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 875 1308 5.0E-30
sp|Q10201|YBX7_SCHPO Uncharacterized protein C17D1.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC17D1.07c PE=3 SV=2 259 458 2.0E-14
sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 268 378 4.0E-10
sp|O14185|STG1_SCHPO Transgelin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stg1 PE=3 SV=1 268 366 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0043087 regulation of GTPase activity Yes
GO:0005515 protein binding Yes
GO:0050790 regulation of catalytic activity No
GO:0065007 biological regulation No
GO:0065009 regulation of molecular function No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0051336 regulation of hydrolase activity No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2432
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4683
Ophiocordyceps australis map64 (Brazil) OphauB2|4493
Ophiocordyceps camponoti-floridani Ophcf2|03312
Ophiocordyceps camponoti-rufipedis Ophun1|5346 (this protein)
Ophiocordyceps kimflemingae Ophio5|3524
Ophiocordyceps subramaniannii Hirsu2|3452

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5346
MSSQPQPLRNPLAVDPLSPSRDILGRYPSTSASSATKPSQPCRLQSDVLARARNFEAGAMDVSVASPGSPRGLNR
KSLCLLPQGPASSPPRPPGTPPGSKVSRHERGKSVDVGRLAFALADGPPSPVSPLRPKSARPISMLLTRSDTGLA
ASATSANNNSSNNYNNASQPIHHASIGRPDLELLGKSSTRELRTLSRLAQSESADGFAITSPAQEVVGLRGRRRL
QRMDKPNGGRDSKTAGYSWEGRNWMDKQRQFLQAYEYLCHIGEAKEWVEDVISKSLPPIVELEEALRDGVTLAEI
VEALNPDKRYRIFHHPKLQYRHSDNIAIFFRYLDEVELPDLFRFELIDLYEKKNIPKVIYCIHALSWLLFRKGIV
DFRIGNLVGQLEFEPHELEAMQKGLDKLGANMPSFGNMGADFGVAEPEPEPQETEQERIDRELSEVEETILELQA
QSRGSMLRMRLGTTMQRLWDSEDSFVDLQSRIRGDFTRQIMSYRLQMRRSAILVQSSVRGFLVRQRLRQNDESCK
ALEPLILDLQSAIRANKVRGDLRDLRSLLKTCSGPVREIQAKSRGFLARQKHVAQQRETRASSEPVRKLQAAARA
MLLRERIHDQLRLLDDSSDVITHVQAAARGSQTRARLSDEREHLRAFESTWTSLQAEIRGATARGRHLALNGELE
QQAGGVAQLQASIRAALVRREVTAQLDELESHREDVAAVQSHIRGVLLRQDISALRRRLDRHTGPTVDLQACGRG
QLVRQHYEGLLEELHSHDGSVAAFQAILKAMMERARIEDLVAELTEEEDSIVAFQSVAKGFLVRARFEEKKRFFD
ENMQKVVKIQSFVRAKVQGEAYKSLTTGKNPPVNAVKNFVHLLNDSDFDFNEELEFERMRKTVVQQVRQNEMLEQ
YIDQLDIKIALLVKNKITLDEVVRHQHNYGGSSVGLLANSSMSSNNQFDLKALNKSSRKKLESYQQLFFSLQTQP
QYLARLFKRMREQGTAEKECKRIELLIMSLFGYAQKRREEYYLLKLIARSIREEIEGAAMLQEYVRGNYFWARLL
GNYTRSPRDRKYLRSLLGPLIRDNFIEDPALDLESDPMQIYRSAINNEELRTGRPDQRPLDVPREVAIRDPETRR
LFIDHLRDLREICDQFFTALEDLLHKMPYGLRFLCGQMFDALCQHFTRESQGQLLQVVANWLWKFYLQPALTSPE
HVGVVERTLSPLQKRNLGEVAKVIGQVASGRPFGGDNIYLQPLNAFVTESMDRLRLMMRELMAVPDAERTFDIDE
FNDLYAKNKPTLYIKMTDIFAMHNLVAAELATMCPTRDDVLGEIMSDLGSAKSNENEMRAAGSSDIHMFLTAKLH
DVDDPEEEVKALFMETKRCVLYIIRVQTGANLLDILVKPITAEDEQRWRDLLRDDFSDDSETRGAYSDANMVDVT
RMTYHELKRTALENVMRLEQMGRISKHNLYQDVLNAIASDIRTKSRRRVQRQRELEGVRLTLGNLHEKAKYLEQQ
RRSYDDYIEQAMATLQNKKGKKRFLLPFTKQYNHQRELERSGRVPKFGSFKYSARALSDKGVLVSWSGLGDRDVD
KINLTISCDEVGIFALEGSRGHIQMPGASALVSIEDLLQAQFESHQFMHIFEGNLKLNVNLLLHLIYKKFYRTA*
Coding >Ophun1|5346
ATGTCCTCCCAGCCTCAGCCGCTCCGCAATCCGCTCGCCGTCGACCCTCTCTCCCCTTCCCGCGATATTCTCGGC
CGATATCCCTCGACATCTGCCAGCAGCGCTACCAAGCCCTCACAACCCTGTCGCCTTCAGAGCGATGTCTTAGCT
CGTGCCCGCAACTTCGAAGCCGGCGCAATGGACGTCTCCGTTGCCTCCCCCGGGAGCCCTCGAGGCCTCAATCGC
AAGTCGCTTTGTCTCCTCCCTCAGGGCCCGGCCTCCTCTCCGCCCCGTCCGCCGGGGACCCCCCCGGGTAGCAAG
GTCTCCAGACATGAGCGAGGCAAGAGCGTCGACGTCGGCAGGCTGGCCTTTGCGCTGGCCGATGGCCCTCCTTCT
CCCGTCTCGCCATTACGGCCCAAGTCTGCGCGGCCCATCTCCATGTTGCTGACCAGGTCCGATACTGGCCTCGCA
GCAAGCGCCACCTCCGCCAACAACAACAGCAGCAACAACTATAACAACGCTTCGCAGCCGATTCATCATGCCTCC
ATCGGCCGACCTGACCTCGAGCTTCTCGGAAAATCTTCCACGCGGGAGCTGCGCACTCTGTCGCGTCTCGCCCAG
TCCGAGTCCGCTGATGGCTTCGCCATCACGTCACCTGCCCAAGAGGTCGTCGGGCTCCGCGGTCGGCGCCGGCTA
CAGCGTATGGATAAGCCCAATGGTGGCCGCGACTCTAAGACGGCCGGCTACAGCTGGGAGGGCCGCAACTGGATG
GACAAGCAGCGCCAATTTCTCCAGGCCTATGAGTACCTCTGCCACATAGGAGAGGCCAAGGAATGGGTCGAAGAC
GTCATCAGCAAGTCCCTACCTCCCATTGTCGAACTCGAAGAGGCCCTCCGAGATGGCGTCACACTGGCCGAGATT
GTCGAAGCCCTCAACCCCGACAAGCGTTACCGAATATTCCACCACCCTAAACTCCAGTACCGTCACTCCGACAAC
ATCGCCATCTTCTTCCGCTACCTCGACGAGGTCGAGCTCCCTGACCTATTCCGGTTCGAGCTCATAGATCTGTAC
GAAAAGAAGAACATACCCAAGGTCATATACTGCATACACGCCCTGAGTTGGTTGCTTTTTCGCAAGGGCATCGTC
GACTTCCGGATAGGCAACCTCGTCGGGCAGCTCGAGTTTGAGCCTCACGAGCTCGAAGCTATGCAAAAGGGCCTC
GATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAATATGGGAGCCGACTTTGGCGTCGCCGAGCCCGAGCCCGAA
CCGCAAGAGACAGAACAGGAGAGGATCGATCGGGAGCTGTCAGAGGTCGAAGAGACCATTCTCGAATTGCAGGCG
CAGAGTCGCGGTTCTATGCTGCGAATGCGCCTCGGCACGACGATGCAACGATTGTGGGACAGCGAGGACAGTTTC
GTCGACTTGCAGTCGCGCATTCGAGGTGACTTTACGCGTCAGATTATGAGCTATCGGCTTCAGATGCGAAGGTCC
GCTATCCTCGTCCAGAGTTCTGTACGCGGCTTTCTCGTTCGCCAGAGGTTACGGCAGAACGACGAGTCTTGCAAG
GCCCTGGAGCCTCTCATCTTGGACTTGCAAAGCGCCATCCGCGCCAACAAAGTCCGCGGGGACCTGCGAGACCTC
AGATCTCTCTTGAAGACATGCAGTGGACCTGTCCGGGAGATCCAGGCCAAGTCCCGGGGCTTTTTGGCCCGTCAG
AAGCACGTAGCGCAGCAAAGGGAGACGAGGGCCTCATCGGAGCCCGTTCGGAAATTGCAAGCTGCCGCCCGAGCG
ATGTTACTGAGGGAAAGAATCCACGACCAGCTTCGTCTTCTGGACGACAGTTCCGATGTCATTACTCACGTACAG
GCTGCTGCCAGAGGCTCTCAGACCAGAGCCCGGCTTTCTGACGAGCGAGAGCATCTGCGGGCGTTCGAGTCGACG
TGGACCTCGCTTCAGGCCGAGATCCGCGGAGCCACCGCCCGAGGTCGGCACCTGGCCCTCAACGGCGAGCTGGAG
CAACAAGCTGGAGGCGTCGCTCAACTCCAGGCGTCAATACGAGCTGCATTGGTGCGGAGAGAGGTGACGGCTCAG
CTGGACGAGTTGGAGTCTCACAGGGAAGATGTCGCGGCCGTCCAGTCCCATATCCGAGGTGTGCTGCTACGACAG
GACATTTCCGCGCTCCGGCGACGTCTCGATCGTCACACCGGTCCAACGGTCGACCTCCAGGCGTGCGGCCGAGGA
CAGCTCGTCCGACAGCATTACGAAGGCCTGCTGGAAGAGCTGCATTCTCACGACGGATCGGTTGCTGCCTTCCAG
GCCATCTTGAAAGCCATGATGGAGCGTGCACGAATAGAAGACCTGGTGGCCGAATTGACGGAAGAAGAGGATTCC
ATCGTTGCCTTTCAGTCCGTGGCCAAGGGATTCCTTGTCCGAGCTCGGTTCGAGGAGAAGAAGCGGTTCTTCGAC
GAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTTGTGCGGGCCAAGGTGCAGGGCGAGGCGTACAAGAGCCTC
ACGACTGGCAAGAACCCGCCGGTGAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGTGACTTTGACTTC
AACGAGGAGCTCGAGTTTGAGAGGATGCGCAAGACGGTGGTGCAGCAGGTGCGACAGAACGAGATGCTGGAGCAG
TACATTGACCAGCTCGACATCAAGATCGCCCTCCTGGTGAAGAACAAGATTACGCTGGACGAGGTGGTGCGTCAC
CAGCACAACTACGGAGGCAGCTCGGTCGGTCTCCTGGCCAACTCGTCCATGTCGTCCAACAACCAGTTCGACCTC
AAGGCTCTCAACAAGAGCTCGCGGAAGAAGCTCGAGTCGTACCAACAGCTCTTCTTCAGCCTGCAGACCCAGCCG
CAGTATCTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAGGGGACGGCAGAGAAGGAGTGCAAGAGGATCGAGCTT
CTCATCATGAGTCTCTTTGGCTATGCGCAAAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCGAGATCG
ATCCGCGAGGAGATTGAGGGCGCGGCCATGCTGCAAGAGTACGTCCGAGGAAACTACTTCTGGGCGAGGCTTCTG
GGCAACTACACGCGCTCGCCGAGGGATCGCAAGTATCTGCGAAGCCTCCTCGGGCCGCTGATCCGGGACAACTTC
ATCGAGGACCCGGCCCTGGACCTGGAAAGCGATCCGATGCAGATCTATCGTTCGGCCATCAATAACGAGGAGCTG
CGGACCGGACGACCCGATCAGCGACCGCTGGATGTTCCTCGCGAGGTGGCCATCCGGGACCCGGAAACCCGACGG
CTCTTCATCGACCACCTGCGAGACCTGCGCGAGATCTGCGACCAGTTCTTCACGGCGCTCGAGGACCTGCTGCAC
AAGATGCCCTACGGCCTCCGCTTCCTGTGCGGGCAGATGTTCGACGCGCTCTGCCAGCACTTTACGAGGGAGTCG
CAGGGCCAGCTGCTGCAGGTGGTGGCCAACTGGCTGTGGAAGTTTTACCTGCAGCCGGCGCTGACGTCTCCGGAA
CACGTGGGCGTGGTGGAGAGGACGCTGAGCCCGCTGCAGAAGAGGAACCTGGGCGAGGTGGCCAAGGTGATTGGA
CAGGTGGCTTCCGGGCGGCCGTTTGGGGGGGATAACATCTACCTGCAGCCGCTCAACGCGTTCGTGACGGAGTCG
ATGGATCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGACGCGGAGCGGACGTTTGATATCGACGAG
TTCAACGACCTGTACGCCAAGAACAAGCCGACGCTGTACATCAAGATGACGGACATATTTGCCATGCACAACCTG
GTGGCGGCGGAGCTGGCGACCATGTGCCCGACGCGTGACGACGTCCTGGGCGAGATCATGAGCGACCTGGGGAGC
GCTAAGAGCAACGAGAACGAGATGAGGGCGGCCGGGTCTTCGGACATTCACATGTTTCTGACGGCCAAGTTGCAC
GACGTCGACGACCCGGAGGAGGAGGTCAAGGCCTTGTTCATGGAGACGAAGCGCTGCGTGCTGTACATTATCAGG
GTACAGACGGGCGCCAACCTCTTGGACATTCTCGTCAAGCCCATCACGGCCGAGGACGAGCAGCGGTGGCGGGAC
CTGCTCCGGGACGACTTCTCAGACGACAGCGAGACGCGAGGCGCCTACTCGGACGCCAACATGGTGGACGTGACG
CGGATGACGTACCACGAGCTGAAGCGGACGGCGCTGGAGAATGTGATGCGACTGGAGCAGATGGGCCGCATTTCC
AAGCACAACCTGTACCAGGACGTGCTCAACGCCATAGCCAGCGACATCCGGACTAAGAGCCGGCGTCGGGTGCAG
AGGCAGAGGGAGCTCGAGGGCGTGCGACTGACGCTGGGCAACCTTCACGAAAAGGCCAAGTACCTGGAGCAGCAG
CGGAGAAGCTACGACGACTACATCGAGCAGGCCATGGCGACGCTGCAGAACAAAAAGGGGAAGAAGCGGTTCCTT
CTGCCCTTTACGAAGCAGTATAACCACCAGCGCGAGCTGGAGCGCAGCGGGCGCGTGCCCAAGTTCGGCAGCTTC
AAGTACAGCGCGCGGGCGCTGTCGGACAAGGGGGTGCTCGTCTCGTGGAGCGGACTGGGAGACCGCGACGTGGAC
AAGATCAACCTGACGATATCGTGCGACGAGGTGGGCATATTTGCGCTAGAGGGGTCACGCGGCCACATCCAGATG
CCCGGAGCCAGCGCGCTGGTATCCATCGAGGACCTGTTGCAGGCCCAGTTCGAGTCGCACCAGTTCATGCACATC
TTTGAGGGCAACCTGAAGCTCAACGTCAACCTGCTGTTGCACCTCATCTACAAGAAGTTTTACCGGACGGCGTGA
Transcript >Ophun1|5346
ATGTCCTCCCAGCCTCAGCCGCTCCGCAATCCGCTCGCCGTCGACCCTCTCTCCCCTTCCCGCGATATTCTCGGC
CGATATCCCTCGACATCTGCCAGCAGCGCTACCAAGCCCTCACAACCCTGTCGCCTTCAGAGCGATGTCTTAGCT
CGTGCCCGCAACTTCGAAGCCGGCGCAATGGACGTCTCCGTTGCCTCCCCCGGGAGCCCTCGAGGCCTCAATCGC
AAGTCGCTTTGTCTCCTCCCTCAGGGCCCGGCCTCCTCTCCGCCCCGTCCGCCGGGGACCCCCCCGGGTAGCAAG
GTCTCCAGACATGAGCGAGGCAAGAGCGTCGACGTCGGCAGGCTGGCCTTTGCGCTGGCCGATGGCCCTCCTTCT
CCCGTCTCGCCATTACGGCCCAAGTCTGCGCGGCCCATCTCCATGTTGCTGACCAGGTCCGATACTGGCCTCGCA
GCAAGCGCCACCTCCGCCAACAACAACAGCAGCAACAACTATAACAACGCTTCGCAGCCGATTCATCATGCCTCC
ATCGGCCGACCTGACCTCGAGCTTCTCGGAAAATCTTCCACGCGGGAGCTGCGCACTCTGTCGCGTCTCGCCCAG
TCCGAGTCCGCTGATGGCTTCGCCATCACGTCACCTGCCCAAGAGGTCGTCGGGCTCCGCGGTCGGCGCCGGCTA
CAGCGTATGGATAAGCCCAATGGTGGCCGCGACTCTAAGACGGCCGGCTACAGCTGGGAGGGCCGCAACTGGATG
GACAAGCAGCGCCAATTTCTCCAGGCCTATGAGTACCTCTGCCACATAGGAGAGGCCAAGGAATGGGTCGAAGAC
GTCATCAGCAAGTCCCTACCTCCCATTGTCGAACTCGAAGAGGCCCTCCGAGATGGCGTCACACTGGCCGAGATT
GTCGAAGCCCTCAACCCCGACAAGCGTTACCGAATATTCCACCACCCTAAACTCCAGTACCGTCACTCCGACAAC
ATCGCCATCTTCTTCCGCTACCTCGACGAGGTCGAGCTCCCTGACCTATTCCGGTTCGAGCTCATAGATCTGTAC
GAAAAGAAGAACATACCCAAGGTCATATACTGCATACACGCCCTGAGTTGGTTGCTTTTTCGCAAGGGCATCGTC
GACTTCCGGATAGGCAACCTCGTCGGGCAGCTCGAGTTTGAGCCTCACGAGCTCGAAGCTATGCAAAAGGGCCTC
GATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAATATGGGAGCCGACTTTGGCGTCGCCGAGCCCGAGCCCGAA
CCGCAAGAGACAGAACAGGAGAGGATCGATCGGGAGCTGTCAGAGGTCGAAGAGACCATTCTCGAATTGCAGGCG
CAGAGTCGCGGTTCTATGCTGCGAATGCGCCTCGGCACGACGATGCAACGATTGTGGGACAGCGAGGACAGTTTC
GTCGACTTGCAGTCGCGCATTCGAGGTGACTTTACGCGTCAGATTATGAGCTATCGGCTTCAGATGCGAAGGTCC
GCTATCCTCGTCCAGAGTTCTGTACGCGGCTTTCTCGTTCGCCAGAGGTTACGGCAGAACGACGAGTCTTGCAAG
GCCCTGGAGCCTCTCATCTTGGACTTGCAAAGCGCCATCCGCGCCAACAAAGTCCGCGGGGACCTGCGAGACCTC
AGATCTCTCTTGAAGACATGCAGTGGACCTGTCCGGGAGATCCAGGCCAAGTCCCGGGGCTTTTTGGCCCGTCAG
AAGCACGTAGCGCAGCAAAGGGAGACGAGGGCCTCATCGGAGCCCGTTCGGAAATTGCAAGCTGCCGCCCGAGCG
ATGTTACTGAGGGAAAGAATCCACGACCAGCTTCGTCTTCTGGACGACAGTTCCGATGTCATTACTCACGTACAG
GCTGCTGCCAGAGGCTCTCAGACCAGAGCCCGGCTTTCTGACGAGCGAGAGCATCTGCGGGCGTTCGAGTCGACG
TGGACCTCGCTTCAGGCCGAGATCCGCGGAGCCACCGCCCGAGGTCGGCACCTGGCCCTCAACGGCGAGCTGGAG
CAACAAGCTGGAGGCGTCGCTCAACTCCAGGCGTCAATACGAGCTGCATTGGTGCGGAGAGAGGTGACGGCTCAG
CTGGACGAGTTGGAGTCTCACAGGGAAGATGTCGCGGCCGTCCAGTCCCATATCCGAGGTGTGCTGCTACGACAG
GACATTTCCGCGCTCCGGCGACGTCTCGATCGTCACACCGGTCCAACGGTCGACCTCCAGGCGTGCGGCCGAGGA
CAGCTCGTCCGACAGCATTACGAAGGCCTGCTGGAAGAGCTGCATTCTCACGACGGATCGGTTGCTGCCTTCCAG
GCCATCTTGAAAGCCATGATGGAGCGTGCACGAATAGAAGACCTGGTGGCCGAATTGACGGAAGAAGAGGATTCC
ATCGTTGCCTTTCAGTCCGTGGCCAAGGGATTCCTTGTCCGAGCTCGGTTCGAGGAGAAGAAGCGGTTCTTCGAC
GAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTTGTGCGGGCCAAGGTGCAGGGCGAGGCGTACAAGAGCCTC
ACGACTGGCAAGAACCCGCCGGTGAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGTGACTTTGACTTC
AACGAGGAGCTCGAGTTTGAGAGGATGCGCAAGACGGTGGTGCAGCAGGTGCGACAGAACGAGATGCTGGAGCAG
TACATTGACCAGCTCGACATCAAGATCGCCCTCCTGGTGAAGAACAAGATTACGCTGGACGAGGTGGTGCGTCAC
CAGCACAACTACGGAGGCAGCTCGGTCGGTCTCCTGGCCAACTCGTCCATGTCGTCCAACAACCAGTTCGACCTC
AAGGCTCTCAACAAGAGCTCGCGGAAGAAGCTCGAGTCGTACCAACAGCTCTTCTTCAGCCTGCAGACCCAGCCG
CAGTATCTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAGGGGACGGCAGAGAAGGAGTGCAAGAGGATCGAGCTT
CTCATCATGAGTCTCTTTGGCTATGCGCAAAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCGAGATCG
ATCCGCGAGGAGATTGAGGGCGCGGCCATGCTGCAAGAGTACGTCCGAGGAAACTACTTCTGGGCGAGGCTTCTG
GGCAACTACACGCGCTCGCCGAGGGATCGCAAGTATCTGCGAAGCCTCCTCGGGCCGCTGATCCGGGACAACTTC
ATCGAGGACCCGGCCCTGGACCTGGAAAGCGATCCGATGCAGATCTATCGTTCGGCCATCAATAACGAGGAGCTG
CGGACCGGACGACCCGATCAGCGACCGCTGGATGTTCCTCGCGAGGTGGCCATCCGGGACCCGGAAACCCGACGG
CTCTTCATCGACCACCTGCGAGACCTGCGCGAGATCTGCGACCAGTTCTTCACGGCGCTCGAGGACCTGCTGCAC
AAGATGCCCTACGGCCTCCGCTTCCTGTGCGGGCAGATGTTCGACGCGCTCTGCCAGCACTTTACGAGGGAGTCG
CAGGGCCAGCTGCTGCAGGTGGTGGCCAACTGGCTGTGGAAGTTTTACCTGCAGCCGGCGCTGACGTCTCCGGAA
CACGTGGGCGTGGTGGAGAGGACGCTGAGCCCGCTGCAGAAGAGGAACCTGGGCGAGGTGGCCAAGGTGATTGGA
CAGGTGGCTTCCGGGCGGCCGTTTGGGGGGGATAACATCTACCTGCAGCCGCTCAACGCGTTCGTGACGGAGTCG
ATGGATCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGACGCGGAGCGGACGTTTGATATCGACGAG
TTCAACGACCTGTACGCCAAGAACAAGCCGACGCTGTACATCAAGATGACGGACATATTTGCCATGCACAACCTG
GTGGCGGCGGAGCTGGCGACCATGTGCCCGACGCGTGACGACGTCCTGGGCGAGATCATGAGCGACCTGGGGAGC
GCTAAGAGCAACGAGAACGAGATGAGGGCGGCCGGGTCTTCGGACATTCACATGTTTCTGACGGCCAAGTTGCAC
GACGTCGACGACCCGGAGGAGGAGGTCAAGGCCTTGTTCATGGAGACGAAGCGCTGCGTGCTGTACATTATCAGG
GTACAGACGGGCGCCAACCTCTTGGACATTCTCGTCAAGCCCATCACGGCCGAGGACGAGCAGCGGTGGCGGGAC
CTGCTCCGGGACGACTTCTCAGACGACAGCGAGACGCGAGGCGCCTACTCGGACGCCAACATGGTGGACGTGACG
CGGATGACGTACCACGAGCTGAAGCGGACGGCGCTGGAGAATGTGATGCGACTGGAGCAGATGGGCCGCATTTCC
AAGCACAACCTGTACCAGGACGTGCTCAACGCCATAGCCAGCGACATCCGGACTAAGAGCCGGCGTCGGGTGCAG
AGGCAGAGGGAGCTCGAGGGCGTGCGACTGACGCTGGGCAACCTTCACGAAAAGGCCAAGTACCTGGAGCAGCAG
CGGAGAAGCTACGACGACTACATCGAGCAGGCCATGGCGACGCTGCAGAACAAAAAGGGGAAGAAGCGGTTCCTT
CTGCCCTTTACGAAGCAGTATAACCACCAGCGCGAGCTGGAGCGCAGCGGGCGCGTGCCCAAGTTCGGCAGCTTC
AAGTACAGCGCGCGGGCGCTGTCGGACAAGGGGGTGCTCGTCTCGTGGAGCGGACTGGGAGACCGCGACGTGGAC
AAGATCAACCTGACGATATCGTGCGACGAGGTGGGCATATTTGCGCTAGAGGGGTCACGCGGCCACATCCAGATG
CCCGGAGCCAGCGCGCTGGTATCCATCGAGGACCTGTTGCAGGCCCAGTTCGAGTCGCACCAGTTCATGCACATC
TTTGAGGGCAACCTGAAGCTCAACGTCAACCTGCTGTTGCACCTCATCTACAAGAAGTTTTACCGGACGGCGTGA
Gene >Ophun1|5346
ATGTCCTCCCAGCCTCAGCCGCTCCGCAATCCGCTCGCCGTCGACCCTCTCTCCCCTTCCCGCGATATTCTCGGC
CGATATCCCTCGACATCTGCCAGCAGCGCTACCAAGCCCTCACAACCCTGTCGCCTTCAGAGCGATGTCTTAGCT
CGTGCCCGCAACTTCGAAGCCGGCGCAATGGACGTCTCCGTTGCCTCCCCCGGGAGCCCTCGAGGCCTCAATCGC
AAGTCGCTTTGTCTCCTCCCTCAGGGCCCGGCCTCCTCTCCGCCCCGTCCGCCGGGGACCCCCCCGGGTAGCAAG
GTCTCCAGACATGAGCGAGGCAAGAGCGTCGACGTCGGCAGGCTGGCCTTTGCGCTGGCCGATGGCCCTCCTTCT
CCCGTCTCGCCATTACGGCCCAAGTCTGCGCGGCCCATCTCCATGTTGCTGACCAGGTCCGATACTGGCCTCGCA
GCAAGCGCCACCTCCGCCAACAACAACAGCAGCAACAACTATAACAACGCTTCGCAGCCGATTCATCATGCCTCC
ATCGGCCGACCTGACCTCGAGCTTCTCGGAAAATCTTCCACGCGGGAGCTGCGCACTCTGTCGCGTCTCGCCCAG
TCCGAGTCCGCTGATGGCTTCGCCATCACGTCACCTGCCCAAGAGGTCGTCGGGCTCCGCGGTCGGCGCCGGCTA
CAGCGTATGGATAAGCCCAATGGTGGCCGCGACTCTAAGACGGCCGGCTACAGCTGGGAGGGCCGCAACTGGATG
GACAAGCAGCGCCAATTTCTCCAGGCCTATGAGTACCTCTGCCACATAGGAGAGGCCAAGGAATGGGTCGAAGAC
GTCATCAGCAAGTCCCTACCTCCCATTGTCGAACTCGAAGAGGCCCTCCGAGATGGCGTCACACTGGCCGAGATT
GTCGAAGCCCTCAACCCCGACAAGCGTTACCGAATATTCCACCACCCTAAACTCCAGTACCGTCACTCCGACAAC
ATCGCCATCTTCTTCCGCTACCTCGACGAGGTCGAGCTCCCTGACCTATTCCGGTTCGAGCTCATAGATCTGTAC
GAAAAGAAGAACATACCCAAGGTCATATACTGCATACACGCCCTGAGTTGGTTGCTTTTTCGCAAGGGCATCGTC
GACTTCCGGATAGGCAACCTCGTCGGGCAGCTCGAGTTTGAGCCTCACGAGCTCGAAGCTATGCAAAAGGGCCTC
GATAAGCTGGGGGCCAACATGCCGAGCTTCGGTAATATGGGAGCCGACTTTGGCGTCGCCGAGCCCGAGCCCGAA
CCGCAAGAGACAGAACAGGAGAGGATCGATCGGGAGCTGTCAGAGGTCGAAGAGACCATTCTCGAATTGCAGGCG
CAGAGTCGCGGTTCTATGCTGCGAATGCGCCTCGGCACGACGATGCAACGATTGTGGGACAGCGAGGACAGTTTC
GTCGACTTGCAGTCGCGCATTCGAGGTGACTTTACGCGTCAGATTATGAGCTATCGGCTTCAGATGCGAAGGTCC
GCTATCCTCGTCCAGAGTTCTGTACGCGGCTTTCTCGTTCGCCAGAGGTTACGGCAGAACGACGAGTCTTGCAAG
GCCCTGGAGCCTCTCATCTTGGACTTGCAAAGCGCCATCCGCGCCAACAAAGTCCGCGGGGACCTGCGAGACCTC
AGATCTCTCTTGAAGACATGCAGTGGACCTGTCCGGGAGATCCAGGCCAAGTCCCGGGGCTTTTTGGCCCGTCAG
AAGCACGTAGCGCAGCAAAGGGAGACGAGGGCCTCATCGGAGCCCGTTCGGAAATTGCAAGCTGCCGCCCGAGCG
ATGTTACTGAGGGAAAGAATCCACGACCAGCTTCGTCTTCTGGACGACAGTTCCGATGTCATTACTCACGTACAG
GCTGCTGCCAGAGGCTCTCAGACCAGAGCCCGGCTTTCTGACGAGCGAGAGCATCTGCGGGCGTTCGAGTCGACG
TGGACCTCGCTTCAGGCCGAGATCCGCGGAGCCACCGCCCGAGGTCGGCACCTGGCCCTCAACGGCGAGCTGGAG
CAACAAGCTGGAGGCGTCGCTCAACTCCAGGCGTCAATACGAGCTGCATTGGTGCGGAGAGAGGTGACGGCTCAG
CTGGACGAGTTGGAGTCTCACAGGGAAGATGTCGCGGCCGTCCAGTCCCATATCCGAGGTGTGCTGCTACGACAG
GACATTTCCGCGCTCCGGCGACGTCTCGATCGTCACACCGGTCCAACGGTCGACCTCCAGGCGTGCGGCCGAGGA
CAGCTCGTCCGACAGCATTACGAAGGCCTGCTGGAAGAGCTGCATTCTCACGACGGATCGGTTGCTGCCTTCCAG
GCCATCTTGAAAGCCATGATGGAGCGTGCACGAATAGAAGACCTGGTGGCCGAATTGACGGAAGAAGAGGATTCC
ATCGTTGCCTTTCAGTCCGTGGCCAAGGGATTCCTTGTCCGAGCTCGGTTCGAGGAGAAGAAGCGGTTCTTCGAC
GAGAACATGCAGAAAGTGGTCAAGATCCAGAGTTTTGTGCGGGCCAAGGTGCAGGGCGAGGCGTACAAGAGCCTC
ACGACTGGCAAGAACCCGCCGGTGAACGCGGTCAAGAACTTTGTGCACCTGCTCAACGACAGTGACTTTGACTTC
AACGAGGAGCTCGAGTTTGAGAGGATGCGCAAGACGGTGGTGCAGCAGGTGCGACAGAACGAGATGCTGGAGCAG
TACATTGACCAGCTCGACATCAAGATCGCCCTCCTGGTGAAGAACAAGATTACGCTGGACGAGGTGGTGCGTCAC
CAGCACAACTACGGAGGCAGCTCGGTCGGTCTCCTGGCCAACTCGTCCATGTCGTCCAACAACCAGTTCGACCTC
AAGGCTCTCAACAAGAGCTCGCGGAAGAAGCTCGAGTCGTACCAACAGCTCTTCTTCAGCCTGCAGACCCAGCCG
CAGTATCTGGCCCGGCTCTTCAAGCGCATGCGCGAGCAGGGGACGGCAGAGAAGGAGTGCAAGAGGATCGAGCTT
CTCATCATGAGTCTCTTTGGCTATGCGCAAAAGCGACGAGAGGAATACTACCTGCTGAAGCTGATTGCGAGATCG
ATCCGCGAGGAGATTGAGGGCGCGGCCATGCTGCAAGAGTACGTCCGAGGAAACTACTTCTGGGCGAGGCTTCTG
GGCAACTACACGCGCTCGCCGAGGGATCGCAAGTATCTGCGAAGCCTCCTCGGGCCGCTGATCCGGGACAACTTC
ATCGAGGACCCGGCCCTGGACCTGGAAAGCGATCCGATGCAGATCTATCGTTCGGCCATCAATAACGAGGAGCTG
CGGACCGGACGACCCGATCAGCGACCGCTGGATGTTCCTCGCGAGGTGGCCATCCGGGACCCGGAAACCCGACGG
CTCTTCATCGACCACCTGCGAGACCTGCGCGAGATCTGCGACCAGTTCTTCACGGCGCTCGAGGACCTGCTGCAC
AAGATGCCCTACGGCCTCCGCTTCCTGTGCGGGCAGATGTTCGACGCGCTCTGCCAGCACTTTACGAGGGAGTCG
CAGGGCCAGCTGCTGCAGGTGGTGGCCAACTGGCTGTGGAAGTTTTACCTGCAGCCGGCGCTGACGTCTCCGGAA
CACGTGGGCGTGGTGGAGAGGACGCTGAGCCCGCTGCAGAAGAGGAACCTGGGCGAGGTGGCCAAGGTGATTGGA
CAGGTGGCTTCCGGGCGGCCGTTTGGGGGGGATAACATCTACCTGCAGCCGCTCAACGCGTTCGTGACGGAGTCG
ATGGATCGGCTGCGGCTGATGATGAGGGAGCTGATGGCGGTGCCGGACGCGGAGCGGACGTTTGATATCGACGAG
TTCAACGACCTGTACGCCAAGAACAAGCCGACGCTGTACATCAAGATGACGGACATATTTGCCATGCACAACCTG
GTGGCGGCGGAGCTGGCGACCATGTGCCCGACGCGTGACGACGTCCTGGGCGAGATCATGAGCGACCTGGGGAGC
GCTAAGAGCAACGAGAACGAGATGAGGGCGGCCGGGTCTTCGGACATTCACATGTTTCTGACGGCCAAGTTGCAC
GACGTCGACGACCCGGAGGAGGAGGTCAAGGCCTTGTTCATGGAGACGAAGCGCTGCGTGCTGTACATTATCAGG
GTACAGACGGGCGCCAACCTCTTGGACATTCTCGTCAAGCCCATCACGGCCGAGGACGAGCAGCGGTGGCGGGAC
CTGCTCCGGGACGACTTCTCAGACGACAGCGAGACGCGAGGCGCCTACTCGGACGCCAACATGGTGGACGTGACG
CGGATGACGTACCACGAGCTGAAGCGGACGGCGCTGGAGAATGTGATGCGACTGGAGCAGATGGGCCGCATTTCC
AAGCACAACCTGTACCAGGACGTGCTCAACGCCATAGCCAGCGACATCCGGACTAAGAGCCGGCGTCGGGTGCAG
AGGCAGAGGGAGCTCGAGGGCGTGCGACTGACGCTGGGCAACCTTCACGAAAAGGCCAAGTACCTGGAGCAGCAG
CGGAGAAGCTACGACGACTACATCGAGCAGGCCATGGCGACGCTGCAGAACAAAAAGGGGTAAGACCTGTCGGCT
CGAATAGGGGATGTGTGTGTGTGTGTATGTGTGTGTGTGGCTGACGAGACTCTCTGCCCTCTCACAGGAAGAAGC
GGTTCCTTCTGCCCTTTACGAAGCAGTATAACCACCAGCGCGAGCTGGAGCGCAGCGGGCGCGTGCCCAAGTTCG
GCAGCTTCAAGTACAGCGCGCGGGCGCTGTCGGACAAGGGGGTGCTCGTCTCGTGGAGCGGACTGGGAGACCGCG
ACGTGGACAAGATCAACCTGACGATATCGTGCGACGAGGTGGGCATATTTGCGCTAGAGGGGTCACGCGGCCACA
TCCAGATGCCCGGAGCCAGCGCGCTGGTATCCATCGAGGACCTGTTGCAGGCCCAGTTCGAGTCGCACCAGTTCA
TGCACATCTTTGAGGGCAACCTGAAGCTCAACGTCAACCTGCTGTTGCACCTCATCTACAAGAAGTTTTACCGGA
CGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail